KEGG   Bombyx mori (domestic silkworm): 100431169Help
Entry
100431169         CDS       T02817                                 

Gene name
OAR2, BmOAR2.1, BmOAR2.2
Definition
(RefSeq) octopamine receptor
  KO
K22790  octopamine receptor beta
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bmor04030]
    100431169 (OAR2)
G protein-coupled receptors [BR:bmor04030]
 Rhodopsin family
  Biogenic amine
   Octopamine and tryamine
    100431169 (OAR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 100431169
NCBI-ProteinID: NP_001171666
UniProt: D5MQ02
LinkDB All DBs
Position
Un
AA seq 393 aa AA seqDB search
MDRENVTHHAVNATVSATINGTAEEEYDVTQGVFFKLRMSVLLLIVITAVLGNMLVIVSV
MRHRKLRVITNYFVVSLAFADILVAMVVMPFNFSVQFYQGWVFGPIICDLWNSSDVYFTS
TSILHLCCISVDRYYAIVKPLKYPTKMTKKVAFIMLAATWLSPITISYVPIFMGWYTTND
YLQTASSDQCEFKVNKPYAVISSSISFWIPCTIMIFTYLAIFKEANRQEKALHARAGNAM
LMHRHSRDVSDKNGALHINATTPTKDRNILKMKREHKAARTLGIIMGAFILCWLPFFLFY
VSTSLCDTCKCPDVVTVIMFWTGYFNSALNPIIYAYFNRDFRNAFKNTLACAFCSFCRRN
SSDLDALERLDRRGSAQLRVPVASRRASDLASL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggatcgagaaaacgtaacccatcatgcagtcaacgcgactgtaagcgcgacaatcaac
gggacggccgaagaagagtatgacgtcacgcagggcgtgttcttcaaactccggatgtcg
gtgctcctgctcatcgttatcacggctgtgctcgggaacatgctggtcatcgtcagtgtc
atgaggcacaggaagctccgcgtcataaccaactacttcgtcgtatcgttggctttcgcg
gacatcctcgtcgcgatggttgtgatgccgttcaacttcagcgtccagttttaccaggga
tgggtcttcgggccgatcatatgcgatctttggaactcatcagacgtctactttacgtcc
acttctatactgcacttgtgctgtatatcggttgacagatactatgccatagtaaaacct
ttgaagtatccaacgaaaatgacaaaaaaggtggcattcataatgctggcagcgacgtgg
ttaagtccgatcacgatatcttacgtcccgattttcatgggatggtatacgacgaacgat
tacctgcaaacagcgtcgagcgatcagtgcgaattcaaagtgaacaagccatacgcagtg
atctcaagttctatatcattctggataccctgtacgatcatgatattcacttacctagcg
attttcaaggaagcgaatagacaagagaaggctttgcacgctcgggctggtaacgctatg
ctaatgcatcgacactcaagagatgtgagcgacaaaaatggagctctccacataaacgcg
acgacaccgaccaaagacaggaatatcctcaaaatgaaaagggaacacaaagccgcccga
actttgggaattatcatgggagcatttattttgtgctggttgccattttttctgttttac
gtctcgacttctttgtgtgacacgtgcaaatgccccgacgtggtcacggtaataatgttc
tggactggctatttcaattccgcccttaatcctatcatctacgcgtatttcaatagggat
ttccgtaatgccttcaagaacacattagcgtgcgctttttgtagtttctgtagacgcaat
tcctcagatcttgacgcgctggagaggctcgacagaaggggttccgcgcaattacgcgtt
cctgttgcttctaggagggcatcagatttagcgtcgctttga

DBGET integrated database retrieval system