KEGG   Bombyx mori (domestic silkworm): 100533206
Entry
100533206         CDS       T02817                                 

Definition
(RefSeq) buffy
  KO
K20017  Bcl-2 family protein
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor04214  Apoptosis - fly
bmor04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    100533206
   04215 Apoptosis - multiple species
    100533206
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 100533206
NCBI-ProteinID: NP_001191409
UniProt: E9JEG2
LinkDB
AA seq 292 aa
MRRKLSTPLTSLTSVSDELPGLKISPSRSLSPLDRTKRRFSTMVTSAAAAAVTRRLSATI
GWYLASHTQVKPQIVRQGRALCLQYIKTQIRRSTTCVKKQIVMKRLQRMIETECGEEVTC
NSDTGVLSALRALCAALERKRPEAFRHVARQATRAPSAMLRSDTALAELALALARRVTRE
NITWSKIAAVYCICGALAREAAEAAEGEPSLELITAPAAAIADVLHEEPGSWIASHGGWN
GLIDRLRASERDHTSEKNLRFMIGFFVMTFLTLLLFRWLLHTNPSYGDSYIV
NT seq 879 nt   +upstreamnt  +downstreamnt
atgcgtcgaaagctcagcactccgcttacctcgctaaccagcgtttccgatgaattgcct
ggcttgaaaatttcaccaagtcgatctctttcgccgcttgaccgcaccaagcgacggttc
agcacaatggtgacgagcgcagccgctgcagctgtgactcgccgcctgtccgcaactata
ggatggtaccttgccagtcatacacaagtcaaaccgcagatcgtacgccaagggcgtgca
ctttgcctgcaatatattaaaacacagatacgaagatcaactacctgtgtcaaaaagcag
atagttatgaagcgccttcagcgtatgatcgagactgagtgtggagaagaggttacttgt
aatagtgacaccggggtactttctgcactccgcgcgctatgtgcggcgttggagagaaag
cggccggaagcattccgtcatgtcgcgcggcaagcgaccagggctccttcagctatgcta
cgctcagacactgcacttgcagaacttgcacttgcactcgcaagacgggtcacaagggag
aacatcacgtggtcaaagattgccgctgtatattgtatttgcggagcactggctagggaa
gctgctgaggcagcagaaggagagccatcattagagctaatcacagcaccggctgctgca
attgctgacgtcttacacgaggagcctggatcatggatcgcctctcatggaggatggaat
ggactaatagatcgtctgcgcgccagcgaacgtgatcatacatcggagaagaatttacgt
tttatgattggattcttcgtgatgaccttcttgacactgctgctgtttcgatggctttta
catactaacccaagttacggcgactcatatatagtctaa

DBGET integrated database retrieval system