KEGG   Bombyx mori (domestic silkworm): 101736339Help
Entry
101736339         CDS       T02817                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101736339
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bmor03036]
    101736339
Enzymes [BR:bmor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101736339
Chromosome and associated proteins [BR:bmor03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101736339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 Methyltransf_4 PTRF_SDPR
Motif
Other DBs
NCBI-GeneID: 101736339
NCBI-ProteinID: XP_012551119
LinkDB All DBs
Position
Un
AA seq 1158 aa AA seqDB search
MSLKDIFRWVCDDLPEMKAALEYNILCDYDTHSYESMRALCDRFNRAIDSVVALEKGTSL
PAQRLNKYPSRGLLKHILQQTYNQAVADPEKLNQYEPFSPEVYGETSYELVCQMIDQIEI
SADDVFVDLGSGVGQVVLQMAAATPCRICLGVEKAEVPSKYAENMDLHFRMWMKWYGKKY
GEYKLIKGDFLLDEHREKINAATIVFVNNFAFGPHVDHQLKERFADLKDGAKIVSSKSFC
PLNFRITDRNLSDIGTIMHVSEMTPLKGSVSWTGKPVSYYLHIIDRTKLERYFQRLKNPK
LKVSKRGSHNGCEDGEGSGKRNLSAPPTRQPTPDLLNGNSNHSTGSLPERRRKVARPRTV
RGDNGRTRRAAAAKRRVARRSSDESDEESSGTDDAPPGPEPAPREWGAPWASSSDSNRSR
RATSKRVASGGGARRRAARAKRRRTTPAAIAGLDLLHSTTLESTIHNGSVTAPPPGCVGQ
RLSALGVQLQPAERLHSELDIPRSPHTPYSLQLLLDMFRDQYLAFIQRMNTPEYANEIRN
QIEKEKEKNHKLKSRASQLDKQINVLISDSVALLKARMSELGIHANNTVDLLAKAKEIVG
RHKELQSKASKLQAQVNSIEAEQAVLVKQRTFEITEKYRQLGHVPHDAEVTQSIAQECIL
KEISATLAHRKRLHAQVGHLQNEITQMERASEQKPTTSSVPVTPVKMHAVNAKPRKREQR
SRSQEWPEVPDIGKIEEQNPELLAQKILETGRQIEAGKVTKPNVIVNGYTRESERLDRYP
KSTTPNPRPQTQRPSLAHRHSPVKSQKPLNVIGKVQESPKVINFEDRLKSIITSVLNEDQ
EQRKASRQVTPSSPYSNGYVTGRPTAAFPPRRDLRRERFPFERHHHPHQPHQPDYTQVSP
AKLALRRHLSQERLAAPARTIGDLVNGEIERTLEISNQSIINAAVNMSARYHDANGTPAP
HQPLEGTPPTSAVSSSPTDRSTIDFITFTGLAACLQARVLASEYWRGRNGVNGGSNTPNG
SVSGDLEDSRPRSPPPDPHSNTSTPLVDESPDGGRIPEVEGCEEVDESKWQDRIAFRFDQ
IISFASTAIEDKRRRSDEACNTSPDSGIGHGEAAAVAAAAAGGARGDTALQHFPPHHFKK
RLYRRSRWGAADWERPPM
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgaaagatatctttagatgggtttgcgacgatttacccgagatgaaggccgct
ttggagtacaacatactttgcgattacgatactcattcatacgaaagtatgcgagccctt
tgcgaccgtttcaaccgagccatcgattctgtagttgctttggaaaaaggtacgtcctta
ccagcacaacggttaaacaagtatccttcaagaggcttactgaagcacatattacaacaa
acctacaatcaagccgtagcggatcccgaaaaattaaatcaatacgaacccttttctccc
gaggtgtacggtgagacttcttacgagttagtttgtcaaatgatagatcaaatagaaata
tcagctgacgatgtatttgtggacttgggctcaggtgtgggacaggttgtactacaaatg
gcagctgcaacaccgtgtcgcatctgcctcggtgttgaaaaggcagaagttcctagtaaa
tatgctgagaacatggatttgcattttaggatgtggatgaaatggtatggcaaaaagtat
ggagagtataaattaataaaaggcgactttttgttggatgagcatcgggaaaaaataaat
gctgctacaattgtttttgtcaataactttgcatttggaccacacgttgatcaccagcta
aaagaaagatttgcagatttaaaagatggtgcgaaaatagtgtcatcaaaaagcttttgt
ccattaaattttcgaataacggacaggaatctgagtgatattggaaccattatgcacgta
agcgagatgacgccactgaaaggctccgtttcttggacggggaaaccagtatcatattat
ttgcatataatagataggaccaaattggagagatattttcaaagactgaaaaatccgaaa
ctcaaggtcagcaaaaggggttcacataacgggtgtgaagatggagaaggaagcggtaaa
cgaaacctcagtgcccctccaacaagacagcctacgcctgatctactcaacggcaacagc
aatcacagcacgggctcactgccagagcgcagacggaaggtagcacgccctaggactgtc
aggggtgacaatgggcgcacacgtcgtgctgcggccgccaagagacgcgtggcacggcgc
tccagtgacgagagcgacgaggagtctagcggcacagacgacgcaccgcctggaccagaa
cctgcgcccagggagtggggcgctccttgggcctcatcgtccgactccaaccgtagccgt
cgagcgacgagtaagcgcgtggcgtcgggcggaggcgcgcggcggcgagcggcccgcgcc
aagcgacgccgcaccacgcccgccgccatcgccggcctggacttgctgcactccaccacg
ctcgagtccaccatacacaacggctccgtgacggccccgccgccgggctgcgtggggcag
cggctgtcggcgctgggcgtgcagctgcagcccgccgagcgcctgcactccgagctcgac
atcccgcgctcgccgcacaccccctacagcctccagctactgctcgatatgttccgggac
cagtacctcgctttcatccagcgcatgaatacgcctgaatacgccaatgaaatacgaaac
caaatagagaaagaaaaggaaaaaaatcataaattgaaatcgagagcatctcaattggac
aaacaaattaacgtcttaataagtgacagtgtagcacttctcaaagcccgcatgagcgag
cttggcatccacgccaacaacaccgttgacctcttagcgaaagcgaaagaaatcgtcgga
agacacaaagaactgcaaagtaaagcgagtaaattacaagcccaggtgaatagtatagaa
gctgaacaggcagtgctagtaaaacaacggacgtttgaaattactgaaaagtatcggcag
ctcggacacgtaccacatgatgctgaagttactcaaagcatagctcaagagtgtatttta
aaagaaatttcggccactttagcccacaggaaaagattacacgctcaagtgggtcattta
caaaatgaaatcacgcagatggaaagggctagcgaacagaaaccgaccacttcctccgtt
cccgtcactcccgtcaagatgcacgcggttaacgcgaaaccgagaaagagagaacagcgt
tcgcgatcacaagaatggcccgaggttccggatattggcaaaatagaagagcagaacccg
gaactcctcgctcagaagatactcgagacgggacgacagatcgaagccggaaaggtcacc
aaacctaacgtcatagtcaacggatacacgagagaatccgaacgactcgacaggtaccca
aaatcgaccactccgaaccctaggccccagacgcaacgcccgtctctcgctcataggcat
tcgcctgtaaaatcccagaaaccacttaacgttatcggtaaagttcaagaatcaccgaaa
gtgatcaatttcgaagacaggctgaagagtataataacttcggtgttgaacgaagaccaa
gaacagaggaaagcttctcggcaggtgacaccgagcagtccgtacagtaacgggtacgtg
acgggccgacccaccgccgccttcccgccgcgccgcgacctgcgccgggagaggttcccc
ttcgagcgccaccaccacccccaccagccccaccagccggactacacgcaggtttccccg
gctaagctggcgttgcggcgacacctgtcgcaggagcggctcgcggcgccggcgcgcacc
atcggcgacctcgtcaacggcgagatcgagcgcaccctcgagatctccaaccagagcatc
atcaacgcggccgtcaacatgagcgcgcgctatcacgacgccaacgggacgccggccccg
catcaaccgctagaaggtactcccccgacctcagccgtgtcctcgtctcccacggatcgc
agcacgattgattttataacttttacagggctagcggcttgcttacaagcccgtgttttg
gcttctgagtactggcgcggacggaacggcgtcaacggaggttctaatactccgaacggc
agcgtttcgggcgacctggaggattcccgtcctcggtctccgccgcccgatcctcattcg
aacacgtctacccctctggtcgatgaatcaccggacggtggaaggatacccgaagtagaa
ggttgcgaggaagtagacgaaagtaaatggcaagatcgcatagcttttcgttttgatcaa
ataatatcgttcgcgtcgacggcgatcgaggacaagcggcggcgctcggacgaggcgtgc
aacacgtcgcccgactccggcatcgggcacggcgaggcggcggccgtggcggcggcggcg
gcgggcggcgcgcgcggcgacacggcgctgcagcacttcccgccgcaccacttcaagaag
cggctgtaccggcggtcgcgctggggagccgccgactgggagcgcccgccgatgtga

DBGET integrated database retrieval system