KEGG   Bombyx mori (domestic silkworm): 101736417Help
Entry
101736417         CDS       T02817                                 

Definition
(RefSeq) glycogen [starch] synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00500  Starch and sucrose metabolism
bmor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101736417
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bmor01003]
    101736417
Enzymes [BR:bmor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101736417
Glycosyltransferases [BR:bmor01003]
 Polysaccharide
  Storage polysaccharide
   101736417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Sigma_1s
Motif
Other DBs
NCBI-GeneID: 101736417
NCBI-ProteinID: XP_004930739
LinkDB All DBs
Position
Un
AA seq 692 aa AA seqDB search
MSKDRSSRRFYRAESTHDLSSFMDRGRAASDENRWTFECAWEVANKVGGIYTVIRSKAFV
STEEMGDNYCLLGPYKEQCARTEVEEGEFPSDSPLLTAVNAMRSKGYKLHTGTWLVDGNP
QIVLFDIGSGAWQLDAYKQELWDTCSVGIPHLDVEANDAVILGFMVAQFISEFREAVEGR
GGVPARVVAQFHEWQAGIGLIVLRVRHVDVATVFTTHATLLGRYLCAGNTDFYNNLDKFS
VDEEAGKRQIYHRYCMERAASHMAHIFTTVSDITGYEAEYLLKRKPDIITPNGLNVKKFS
ALHEFQNLHALAKDKIHEFVRGHFYGHFNFDLDKTLYFFIAGRYEFGNKGADIFIEALAR
LNHYLKSSGSEVTVVAFLIFPAKTNNFNVESLRGHALTKSLRDTIQHVQQRVGARMYDVC
LRGHVPEPTELLLKEDTVRLKRCIYALQRDGLPPVTTHNVVDDWSDPVLNSIRRCELFNT
VNDSVKVIFHPEFLTSTNPLFGLEYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSIT
TNLSGFGCFMQEHIADPMSYGIYVVDRRYISLEGSVQQLAQYMYDFTKMSRRQRIIQRNR
TERLSDLLDWRNLGIYYRQARARALRTVYPEYVDHADVQLERAFTYPRPLSEPPSPAHSR
ATTPAASVHGSDSEEDEVDDEKELAELRISHD
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaggatcgcagctcgaggcggttctatcgtgcggagtccactcatgatctgtcg
tcattcatggaccgcggccgcgccgccagcgacgagaacagatggaccttcgagtgcgcc
tgggaagtcgccaacaaagttggcggtatttatacggtaataagatcgaaagcattcgtc
tccactgaagaaatgggagacaactattgcttgcttggtccgtataaggagcaatgcgcg
cgaactgaagtcgaagagggagagttcccctccgactcccccctgttgacagccgttaac
gccatgaggagtaaaggttacaagttacacacgggcacttggctggtagatgggaaccct
caaatagttcttttcgacatcgggtctggggcgtggcagttggatgcttacaagcaggag
ctatgggacacttgctccgtcggcatcccgcatctcgacgtggaggccaacgacgccgtg
atcctagggttcatggtcgcgcagttcataagcgagttccgcgaggcggtggaggggcgc
ggtggggtgccggctcgcgtggtggcgcagttccacgagtggcaggcgggaatcgggctc
atcgttctaagggtacgccatgttgacgtggcgaccgtattcacgactcacgcgacgctc
ctcggcagatacctctgcgctggcaacacagacttctacaataacctggataagttctct
gtggacgaggaggcgggaaagagacagatataccaccgctactgcatggagcgggccgcc
tcgcacatggcacacatcttcaccaccgtctccgacatcacgggatacgaagccgagtac
ttgctcaaacggaagccggacatcatcaccccgaacggtttgaacgtgaagaaattctcg
gcgctgcacgagttccagaacctgcacgccctcgccaaggacaagatacacgaattcgtt
aggggacatttttacggccatttcaatttcgatctggacaaaacgttgtatttcttcatc
gccggacgatacgagttcgggaacaagggagccgacatattcattgaggcgctggcgaga
ctcaaccattatttgaagtcgtcgggctccgaggtgacggtggtggcgttcctgatcttc
ccggcgaagacgaacaacttcaacgtggagtccctccgcgggcacgcgctcaccaagtcc
ctgcgcgacaccatccagcacgtgcagcagcgcgtcggcgccaggatgtacgacgtgtgc
cttcggggccacgtgccggagcccaccgagctgctgctgaaggaagacacggtgcgcctc
aaacgctgcatttacgcgctgcagcgggacggcctgccccccgtcaccacgcacaacgtc
gtggacgactggagtgatcctgtgctgaactccataagaagatgcgagctgttcaacact
gtcaatgacagtgtcaaggtgatattccacccggagttcctgacgtccacgaaccccctg
ttcggtctggagtacgaggagttcgtgcgcggctgccacctcggcgtgttcccctcgtac
tacgagccctggggctacacgccggccgagtgcaccgtcatgggcatacctagcatcacg
accaacctgtccgggttcggttgcttcatgcaggagcacatcgcggaccccatgtcctac
gggatctatgtggtggaccggcggtacatctcgctggagggctccgtgcagcagctcgcg
cagtacatgtacgacttcaccaaaatgtctcgccgtcagcgcatcatacagagaaaccga
actgagagactgtcggatctactggactggagaaaccttggaatttactaccgccaggcc
cgcgcacgcgccctgcgcaccgtgtacccggagtacgtggaccacgcggacgtgcagctg
gagcgcgccttcacctacccgcgcccgctgtccgagccgcccagccccgcgcactccaga
gccacgactccggccgcctcggtccatggctccgacagcgaggaggacgaggtggacgac
gagaaggagctggctgagttgaggatcagccacgactga

DBGET integrated database retrieval system