KEGG   Bombyx mori (domestic silkworm): 101736905Help
Entry
101736905         CDS       T02817                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00052  Galactose metabolism
bmor00500  Starch and sucrose metabolism
bmor01100  Metabolic pathways
bmor04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101736905
   00500 Starch and sucrose metabolism
    101736905
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101736905
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmor04147]
    101736905
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101736905
Exosome [BR:bmor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101736905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 Nmad2
Motif
Other DBs
NCBI-GeneID: 101736905
NCBI-ProteinID: XP_012551572
UniProt: H9JRB7
LinkDB All DBs
Position
Un
AA seq 1115 aa AA seqDB search
MPKIPYKPEKSGGNDDDYEIVSFDDFSDKSPGSKTDLLTLNDNINYRLYYEADKQSKYLE
NNGESSKGIDSHTETSLNGARNGSFRKLSNSFVPFGKSGGKTHTPLFSGVKSKNENESSS
REHRYQRFSENSTFMQRVCDMMPGTGSSVLAIILLCGLSLASYWAVGGTIGGSWGEEHYK
KLWERTHPENVKKPLSPMPHDKQVIPEYRYHDHNNLSTKNRSNGTEAKKKEFSKKNVYVE
RPAAVLRELCALVADNMKFDCYPQGDINEENCVKRGCCWKVTQMKGAPYCYYPSQYDTFR
FVNMTEDKHSMTVFYEKARPSGYPDDFELVRMDFKYMSDEILQIKIYDAENNRFEPPYPE
ISMGSKTLTDMKYRVVLEGSKIGFKVIRNSDDVVIFNTQDVGGLILSDKFLQISAILPTD
HVFGLGEKRARFMNNMDWQTFAIFNRDRAPTEGLNLYGTHPFYLAVEQNGQSHGTLLLNS
NAMDIVLQPSPGITYRATGGVLQLFVLAGPSPALVARQYTELVGRPFMPPYWSLGFHLCK
FNYGNLSVMADVWQRNRDAGIPFDVQWNDIDYMTHSNDFTLDAARYAGLPAFVKRLHSEG
MHYVMIFDIGIGASEKPGTYKAYDRGIEMDIFVKNSSNQPFIGRVWNKGSTVYPDFTHPN
STPYWVEMMTDFHKLVPYDGAWIDMNEPSNFEDGPLHGACAPEQLPYRPRTGDPQLHTHT
LCMDAAHHAGPHRHYHDLVGLMHAVATNFALQEIRGKRPFIISRASFVGLGRYAGHWSGD
ISSQWHDMKMSIPELLSFSLFGVPMMGADICGFNGDTNVELCTRWMQLGAFYPFSRNHNT
DTAIPQDPASLGPAVVQASRAALRTRYKLLPYYYTLFWRAHVLGDTVVRPLLFEFPEMSE
LHDIDTQFMVGPHVMVAPVLEPGTDRARALFPGAQGWYSLATGRHIATNDWAEVLHNDTV
SIKGGGVVVLQEPAARGPVSTGSARSAPLQLLAAPDAAAAASGRLYWDDGDSLHTYEEKK
YSYIEFSLNGTEIQSHVKWWGYGVPLFNQLSILNQPPVKQVLINGMPCVSPCSFTYYKKN
KVLSIMINLSLEKPFNVRWSYDEKYLNRTGASRKN
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaataccatataaaccagaaaagtctggtggaaatgacgatgactacgaaatt
gtttcgttcgatgatttttccgacaaatctccgggttcgaaaactgatttattaactttg
aatgataacataaattatcgtctctattacgaagcagataaacaatcaaaatatctagaa
aacaatggagaatcatccaaaggtattgacagtcatacagaaacgtcgctgaatggagca
agaaatggatcattcagaaaattatcaaattcttttgtcccattcggaaaatccggcggg
aagactcacacgccgttatttagcggcgttaagtctaagaatgaaaatgaatcttcatct
agagaacacagatatcaacgattttcagaaaatagcacgtttatgcagagagtctgcgat
atgatgcctggaactggttcaagtgtactagccataatcttgttgtgcgggttgtccctt
gcaagttattgggcagtcggcggtaccatcggtgggtcctggggcgaggagcattacaag
aaactatgggagagaacgcatcccgaaaatgtgaagaaacctctatcacccatgccacat
gacaagcaggtgatacccgaatacaggtaccacgaccacaacaacttgagcaccaaaaac
agaagcaacggaactgaggctaagaagaaggaattcagtaagaaaaacgtgtacgtggaa
cgtccggccgcagtcttgcgcgagctatgcgcgctcgtcgcggacaatatgaagttcgac
tgctaccctcaaggcgacatcaatgaggagaactgcgtcaaacgaggttgctgctggaag
gttacacagatgaagggcgctccgtactgctactacccgtcgcagtacgacacgttccgt
ttcgtgaacatgaccgaggacaagcactccatgaccgtgttctacgagaaggctcgaccc
tccggttatccggatgactttgaactagtccgaatggattttaaatacatgtccgatgaa
attttacagattaagatatatgatgcggaaaacaaccgattcgaaccaccctacccagaa
atatcgatgggctccaagaccctgacggatatgaaatacagagttgtcttggaaggctcg
aagatagggttcaaagtgataaggaattctgatgatgttgtcattttcaacacccaggac
gtgggagggctgatattatcggacaagttccttcagatatcagcaatacttcccaccgac
cacgtgttcggcctgggagagaagcgagcgaggttcatgaacaacatggactggcagacc
tttgccatattcaacagagacagggcgcccacggaagggcttaatttgtatggcacgcac
cctttctatctggccgtggaacaaaacggacaaagtcacgggacgcttctactcaattct
aacgctatggacatagtgctgcagccgagccccggcatcacgtaccgcgcgacgggcggc
gtgctgcagctgttcgtgctggcgggccccagccccgcgctcgtcgcccgccagtacacg
gagctggtgggcaggcccttcatgccgccctactggtccctgggcttccatctgtgcaag
ttcaactacgggaacctgagcgtcatggcggacgtgtggcagaggaacagagacgctggc
ataccctttgacgtccagtggaacgacatcgactacatgacgcacagcaacgacttcacg
ctggacgccgcccggtacgcggggctgcccgctttcgtgaagaggctgcactccgagggc
atgcactacgtcatgatctttgatattggtattggagcttcagaaaagccgggcacgtat
aaagcctacgaccgaggcatagaaatggacatatttgtgaagaattcttcaaatcaaccg
tttataggaagagtctggaacaaagggtccacggtatatccagacttcactcatccgaat
tcgactccgtattgggtcgaaatgatgacggacttccacaaactcgtcccgtacgacgga
gcgtggatcgacatgaacgagccgtcgaacttcgaggacggtcccctgcacggcgcctgc
gcccccgagcagctcccgtaccgcccgcgcaccggcgacccgcagctgcacacgcacacg
ctgtgcatggacgccgcgcaccacgccggcccgcaccggcactaccacgacctggtgggg
ctcatgcatgccgtggccaccaactttgccttgcaagagatcagagggaagcgtccgttc
atcataagccgtgcgtcgttcgttggactggggaggtacgcgggccactggagcggggac
atcagcagccagtggcacgatatgaagatgtccataccggagctgctgagcttcagtctg
ttcggagtccccatgatgggtgccgacatctgcggcttcaacggcgacaccaacgtggag
ctctgcacgcgctggatgcagctcggagccttctaccccttctcgaggaatcataacacc
gatacagccattccgcaagaccccgcgagcctgggcccggcggtggtgcaggcgagccgc
gccgcgctgcgcacgcgctacaagctgctgccctactactacacgctgttctggcgcgcg
cacgtgctcggcgacaccgtcgtgcgcccgctgctcttcgaatttcccgagatgtctgag
ctacatgacatcgacacccagttcatggtcgggccgcacgtgatggtcgcgccggtgctg
gagcccggcacggaccgcgcccgcgccctgttccccggcgcgcagggctggtacagcctg
gcgacgggccgacacatcgccaccaacgattgggccgaagtcttgcacaacgacactgtc
tctattaagggcggcggcgtggtggtgctgcaggagccggcggcgcgcgggcccgtcagc
accggctcggcccgcagcgcgccgctgcagctgctcgcggcgcccgacgcagccgccgcc
gcaagcggacgcctctactgggacgacggcgacagcctgcacacctacgaagagaagaaa
tacagttacatagaattttcactgaacggcactgaaatccaatcacatgtgaaatggtgg
ggatatggagttccgctgttcaaccagctgtcaattctcaatcagccccccgtcaagcaa
gttctgatcaacggaatgccgtgcgtgtccccctgctcgttcacgtactacaagaagaac
aaagtgttgtccattatgattaatttgtcattagagaaaccattcaacgtcagatggtca
tacgatgagaaatatttgaacaggaccggggcatcgagaaaaaattga

DBGET integrated database retrieval system