KEGG   Bombyx mori (domestic silkworm): 101737600Help
Entry
101737600         CDS       T02817                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bmor01002]
    101737600
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmor04147]
    101737600
   04090 CD Molecules [BR:bmor04090]
    101737600
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101737600
Peptidases [BR:bmor01002]
 Metallo Peptidases
  Family M2
   101737600
Exosome [BR:bmor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101737600
CD molecules [BR:bmor04090]
 Proteins
  101737600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 101737600
NCBI-ProteinID: XP_012550154
LinkDB All DBs
Position
Un
AA seq 790 aa AA seqDB search
MKRAIVFVKAKQLDLPPIPSTSQSGYGLSSTPSSLNSPGNQFDRNYQFSTARPSPTSTPG
VYQVSSTPFNGISPDISNNGYPNVDYNSRNPSSTLRPYDESNGDDRIDINSDPNFRRNDP
NFVRNDPNYVGTNPYDFNRGGDVNSIDDRYRQVNLQQVRDFLAQADDQASKECTNNVAAQ
WNFETNVNDETQHAALDAQQRYTLFQRGLWEAAQQIPRGAIRDFPTFRQLRLLSIIGPAA
LPPDQLDRYNRIINDMLAVYNTAEVCAYNEPFKCGLHLQPELQYIMSHSRDWDELQHIWT
EWRRNTGRRVRDLYEQLVDLTNQAARLNNFTDASAYWMFPYETSNMRQEVDDVWQQIKPL
YDQLHAYVRRRLREAYGPERISRSAPLPAHILGDMWGQSWSGIVPFTLPYPGKNLLDVSQ
EMAKQGFTPLTMFQLAEEYFVSMNMSAMPPDFWALSVLDQPPDRHIHCQPSAWDFCNKHD
YRIKMCTHVDMKDLVTAHHEMAHIEYFLAYRNQPKVFRDGANPGFHEAIGETIALSVGSP
RHLQTLGLVQRSVDDTAHNTNFLFTQAMDKLAFLPFALVMDRWRWDVFTGDVRKEQYNCH
WWRLREQYQGVKPPVLRSELDFDPGSKYHIPANIPYIRYFVSTVLQFQIFRALCERTGQF
IPGDPTRPLHKCDIYRNPEAGRILNRLMERGSSAPWTHILQEAIGESRLNGEAMRDYFRP
LEDWLSSENLRTGEFLGWSYDGDYCKFSIETAGLQVYGGFYNAAQRHYDVTTFIALFVTS
ALVTIAFRYR
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtgcaattgtttttgtcaaggctaaacaattagacctaccgccgattcccagt
acttctcaaagcggctatggcctatctagtactccatcgtctctcaattctcccgggaat
cagtttgacaggaattatcagttcagcactgcgagaccgagtcctaccagcacgcctgga
gtttaccaagtttcctccaccccgttcaacggaataagtccggatataagcaacaatggg
tatccgaatgttgactataacagcagaaaccctagttctacgctccgaccttatgacgaa
agtaacggagacgacagaattgacattaacagtgatccgaacttcagaagaaacgacccc
aactttgtcaggaacgacccgaactacgtaggaactaatccgtatgatttcaatcggggc
ggggatgtaaatagtattgatgatagataccgccaagtgaacttgcagcaggtcagagat
tttctggcacaggctgacgatcaggcttcgaaggaatgcaccaataacgtcgcagcgcag
tggaacttcgaaacaaacgtcaatgatgaaacacagcatgcagcgctggacgcccaacag
cgctacacattgttccagcgaggactatgggaggccgcacagcaaatacctcgtggagct
atcagggactttccgaccttcagacaactccggcttctgtctattataggacctgcagct
ctaccccctgatcaactggataggtacaaccgcataataaacgacatgctggctgtttac
aatactgccgaggtctgcgcctacaacgagccattcaagtgtggtctccatctccaaccg
gagctgcagtacatcatgtcccactccagagactgggacgaacttcagcacatctggacc
gagtggaggaggaatactggtagaagagtacgggatttatacgagcagttggttgatttg
accaatcaggcagccagattgaataattttactgacgcatccgcgtactggatgtttcct
tacgagacctcaaacatgcggcaggaggtcgatgacgtctggcagcagatcaagcccctt
tatgaccagcttcacgcctacgttcgtcgtcgtctgcgagaagcctacggtcctgagaga
atctccagatcggctccgttaccagcccacatcctgggagacatgtggggacagagctgg
tcgggtatcgtgccttttacccttccttaccctgggaaaaacttgctagatgtctctcag
gaaatggcgaagcagggtttcactccactcacaatgtttcaattagctgaagagtacttc
gtgtccatgaatatgtctgccatgcctcctgacttttgggccctaagcgtgttggaccaa
cctccggacagacacatccactgccagccttctgcttgggacttttgcaataagcacgac
tatcgcatcaaaatgtgcacacacgtggacatgaaggatctggtgacggcgcatcatgag
atggcgcacatcgaatatttcctcgcctacaggaatcagccgaaagtcttccgtgatggt
gctaatccaggtttccacgaagctattggtgagacaatagcactgtcagttggatcccct
cgtcacctgcaaaccctaggcctggttcaacgttcggtagacgacacagcccacaacacg
aacttcctgttcacccaagctatggacaagttagcgtttcttccgttcgcgctggtgatg
gacaggtggcgttgggacgtgttcacaggagacgtccgcaaggagcagtacaattgccat
tggtggagattaagggagcagtaccaaggtgtgaagcctcccgtgctgcgttccgagctg
gacttcgaccctggatccaagtaccacataccggccaacataccctacataagatacttc
gtgagcacagtactccagttccagatattcagggcactctgcgagagaacgggccagttc
atcccaggagacccaaccaggccgttgcacaaatgtgacatttacagaaaccctgaggcc
ggaaggattctgaaccgtcttatggagcgaggttcctcagcgccgtggactcatatatta
caagaggccataggtgaatcccgactaaacggggaagccatgagggactacttccgtcct
cttgaagattggctcagcagcgagaaccttcgtaccggagaatttttaggttggagctac
gacggagattattgtaaatttagcattgaaaccgctggtctccaagtctacggagggttc
tacaatgctgctcaacgccactatgacgtcaccactttcatagcactgtttgtgacatca
gcgctcgtgaccatagctttcagatacagatag

DBGET integrated database retrieval system