KEGG   Bombyx mori (domestic silkworm): 101741658Help
Entry
101741658         CDS       T02817                                 

Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bmor01009]
    101741658
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bmor03019]
    101741658
   04131 Membrane trafficking [BR:bmor04131]
    101741658
   03036 Chromosome and associated proteins [BR:bmor03036]
    101741658
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101741658
Protein phosphatases and associated proteins [BR:bmor01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101741658
Messenger RNA biogenesis [BR:bmor03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     101741658
Membrane trafficking [BR:bmor04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    101741658
Chromosome and associated proteins [BR:bmor03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101741658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP zf-UBP_var N6-adenineMlase
Motif
Other DBs
NCBI-GeneID: 101741658
NCBI-ProteinID: XP_012543899
LinkDB All DBs
Position
Un
AA seq 1081 aa AA seqDB search
MATPPPTQSRRSGGDSKKVTPPTSNIVTRNGARKAKIQTRAMSAAAKPSASLIAAKKKAQ
QKKKQNHFVMEIRDHFQIAMESKTLVKGPTGFVTEPRMGEHRCLWDENYPECPERLISVI
KRCQELNLVQRCKHLEPRAATKEELCVLHAPSVYEMLETTHGNDDAAYLEELSSKFDAIY
IHPSTHELALISAGSTIDMVDSIVSGEVQNGAAFVRPPGHHAMHSEPCGYCFYNNVALAA
KHALDKRGLQRILIVDWDVHHGQATQQMFYDDPRVVYFSIHRYEHGSFWPQLRQSDFHYV
GSGAGKGYNFNVPLNKTGMKDGDYLAIWHQLLLPMAYEYQPELIIVSAGYDAAIGCPEGE
MEVSPACYAVLLHALQSVTSRVCVVLEGGYCLTSLAEGAALTLRTLLGDAPPKLEPPTPP
CDSIRDTILDCIYAHRQYWSCYSYQPARGDRHEVLVRWRGDETRPSRFATRDCYPTQDEP
TRRALEDRLDHLRAVTDLTSPTHAVGYVYDEAMLKHRNVVEPGHVESPERIMRIHERHRD
FGLLERLHRLPGRAASDQEILSVHSDKYLDRLKELASTKLRDLNNQKEEYDSVYFHPESL
SSAAVAAGCVLQAVEAVVSGQCGAAACVVRPPGHHAARAAPAGFCLLNNAALAARAAHRV
LLLDWDVHHGNGTQALTYTDDQILYISIHRYDHGSFFPHSKDADYTAVGTGRGEGYNINI
PWNKRGMGDAEYMAAFTQVVLPIAHEYNPDLVIVSAGFDACVGDPLGGCKVTPECYGRMT
QLLRGLAGGRVVLCLEGGYNTTAISYAMTMCTKALLGDPILHHYEPRTACHWSAVETINN
VISTHKKYWKSLAFQLALPSEDVLQRPAPSRGLSDLSDALSSSYEDTKSDSKSGSQLDTS
LEHNMANLSLNKCGDGVHCGTDDEDEAGDTASNSNPESTGNTKSLVDYLSENMQALLEGE
MFAVVPLGWCPHLEALYAIPAGVRFQQGLQCVDCEHTLENWVCLHCYITACARGVNAHMQ
AHWAASGHALVLSLRDLSVWCCACDAYVDHPLLYDAKNNAHRCKFGEDMPWCYAADAVEM
H
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atggctacacctccgccgacgcagtctcgtagatcgggcggtgacagtaagaaagtaacg
ccgccaacgtccaatatagtgaccaggaatggagctcgcaaggccaagattcaaactcga
gcaatgtccgccgcagctaagccttcagcatccttaatagcagctaaaaagaaggctcaa
cagaaaaagaagcaaaatcatttcgtaatggagatcagggatcattttcagattgcgatg
gaatcgaagacattagtgaagggtccaaccggatttgtcaccgagcctcgcatgggagaa
cacaggtgcttgtgggacgaaaattacccagaatgtccggaaaggctcattagtgtcatc
aagaggtgtcaggaactgaacctggtccagcgctgcaagcacttggagccccgcgcggcc
accaaggaggagctctgcgtgctacacgcgccctccgtgtacgaaatgttagagacgaca
cacggaaacgacgacgccgcgtatttggaagagctctcatcgaaattcgacgctatttat
attcatccaagcacgcacgagttggcgctgatatcggccggctcgaccatcgacatggtg
gacagcatcgtgtcgggtgaagtccagaacggcgcggccttcgtgcggccgccgggacac
cacgccatgcactcggagccctgcggctactgcttctacaacaacgtcgctttggccgcc
aagcacgccttggacaaaaggggtctgcaaaggatactgatcgtggactgggacgttcac
cacggacaagccacacagcagatgttctacgacgatcccagagtggtatacttctcgata
caccgctacgagcacggctcgttctggccccagctgcgacagtccgacttccactacgtc
ggcagcggcgccggtaaaggatacaatttcaatgtgcccctcaacaaaaccgggatgaaa
gacggagactatttggccatctggcaccagctgcttctgcccatggcctacgagtaccag
ccggagttgatcatagtatctgcaggatacgacgcggccatcggatgtcccgagggagag
atggaggtgagtccggcgtgctacgcggtcctgctgcacgcgctgcagtcggtgacgtcg
cgcgtgtgcgtggtgctggagggcggctactgcctgacgtcgctggccgagggggccgcc
ctcacgctgcggacgctgctgggcgacgcgccccccaaactggagccccccacgcccccc
tgcgactcaatccgcgacacgatactggactgcatatacgcgcacagacagtactggagc
tgctacagctaccagcccgcgcggggggaccgccacgaggtgctcgtgcggtggcggggc
gacgagacgcgcccgtcgcgcttcgccacccgggactgctacccgacgcaggacgagccc
acccgccgggccctcgaggacagactcgaccacttgcgagcggtgacggatctgacgtca
ccgacccacgcggtcggttacgtgtacgacgaggcgatgctgaagcacaggaacgtggtc
gaaccaggccacgtcgaaagtccggagcgtatcatgaggatccacgagcgacatcgggac
ttcggtctgctggagaggctgcaccggctgcccggccgcgccgcctccgaccaggagata
ctgagcgtgcactccgacaaatatttggacaggttaaaggagctggcgtcgacgaagttg
cgggacctgaataaccagaaggaggagtacgactctgtgtactttcacccggagtcgctg
tccagcgctgctgtggcggccggctgcgtgctgcaggcggtggaggcggtggtgtcgggg
cagtgcggcgccgccgcgtgcgtggtgcgcccgcccggacaccacgccgcccgcgccgcg
cccgccggcttctgtctgctcaacaacgccgcgctggccgcccgcgccgcccaccgcgtg
ctgctgctcgactgggacgtgcaccacgggaacggcacgcaggcgctcacctacaccgac
gaccagatactgtacatatcgatacatcgttacgaccacggctcgttcttcccgcactcg
aaggacgcggactacacggccgtgggcacggggcggggcgagggctacaatatcaacata
ccttggaataagcgcggcatgggtgacgcggagtacatggccgccttcacccaggtcgtg
ctgccgatagctcacgagtataatccggatctggtgatcgtgtcagcggggttcgatgcc
tgcgtgggagacccactgggaggttgtaaagtaactccggagtgctacggccgcatgacg
cagctgctgcgagggctcgccggaggtcgggtggtgctctgtctagagggcggctacaac
accaccgccatctcctacgccatgaccatgtgcaccaaggccctgctgggagaccccata
ctgcaccactacgaaccgaggaccgcctgccactggtccgccgtcgagaccataaacaac
gtcatcagcacgcacaagaagtactggaagagcctcgccttccaactcgctctgccgtct
gaggacgtcctccagcggccggcgccgtcgcgaggcctgtccgacctgtccgacgcgctg
tcgtcttcatacgaggacaccaagtcggactccaagagcggcagtcaactggacacttcc
ctggagcacaacatggccaacctcagtctgaacaaatgtggagacggcgtgcactgcggc
actgacgacgaggacgaggccggcgacaccgcgtccaattctaatccggaatcgactggc
aataccaagagtttagtggattacttgtcggagaacatgcaggcgctcttggagggcgag
atgttcgccgtggtgccgctgggctggtgcccgcacctggaggcgctgtacgccatcccc
gccggggtccgcttccagcagggactccagtgtgtcgactgcgaacacaccctggagaac
tgggtgtgtctgcactgctacattacggcgtgcgcgcgcggcgtgaacgctcacatgcag
gcgcactgggcggcgagcgggcacgcgctggtgctgtccctgcgcgacctgtccgtgtgg
tgctgcgcgtgcgacgcctacgtggaccacccgctgctctacgacgccaagaacaacgcg
caccgctgcaagttcggcgaggacatgccgtggtgctacgccgcagacgccgtagagatg
cactag

DBGET integrated database retrieval system