KEGG   Bombyx mori (domestic silkworm): 101742625Help
Entry
101742625         CDS       T02817                                 

Definition
(RefSeq) fatty acid synthase-like
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00061  Fatty acid biosynthesis
bmor01100  Metabolic pathways
bmor01212  Fatty acid metabolism
Module
bmor_M00082  Fatty acid biosynthesis, initiation
bmor_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101742625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bmor01004]
    101742625
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmor04147]
    101742625
Enzymes [BR:bmor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     101742625
Lipid biosynthesis proteins [BR:bmor01004]
 Fatty acid synthase
  Animal type
   101742625
Exosome [BR:bmor04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101742625
  Exosomal proteins of breast milk
   101742625
  Exosomal proteins of colorectal cancer cells
   101742625
  Exosomal proteins of bladder cancer cells
   101742625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt Ketoacyl-synt_C KAsynt_C_assoc KR Thiolase_N ADH_zinc_N DUF268 ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 101742625
NCBI-ProteinID: XP_012552165
LinkDB All DBs
Position
Un
AA seq 1706 aa AA seqDB search
MVDSQKSSIVLQDSSLPSIIDTTIASRSRPWYNNASRNAVHLKRSAYAAWGGFQERSRSS
RFASVSQSRLNGTSSLIDVNNELTLQFVPAVEFKVNPVTSENSPWLYTPLEIGPYSGKAP
GSQYFDAQFFKVHQRLGEKMDVMSRKLLEQSYQAIYDAGLSPQSLNGKNVAVYIGTSISE
TEITGFLDTSSKRGFGIMGCSKTMFANRISYWLNVKGPSMAVDQACCSSMSALQLAYLAM
KSNECEAAIVGGCHLSMLPESSVHYNRINKIAKDGKTRSFDQEANGCVLSDAINVIFLQK
ASDALRVYADVVHAKNEYISLKQENEFPKSGSYRKPHEIANYLKDFYIEADFAPQDVDYV
EAFGIGNPESDKSELEALTDVFCDKKTNPLYVGSVMSNIGFTAAASGITSIIKDLAKYKS
SIPHLVTVSGRQDSSVKKVLDNLKSRPIDPEELTLFHNIHSVVTPGHLGRGYTILQTQEN
QTVSLGEAVNYFDNAKRPLWFVYSGMGSQWPGMGAELMNIPIFSAAIERCQKAVESKGID
LVKIITSTDPDIFNNILNAFLGIAAIQIGLTDVTYALGLVPDNIIGHSVGELGCAYADGC
LTAEEMILAAYSRGQASIETKLIKGSMAAIGMGYKQILPLCPPEVDVACHNGPDSSTISG
PADVTAHFVAELSAKGIFAKTVPSANIAYHSRYIAAAGSNLLQMLKKVIKNPRLRSERWV
STSVPQEDWNNAAAKYCSPEYQTNNLLNPVLFEETSRLIPNNAILIEIAPRGLLQAILKR
SVSPDCFNISLTKKGDGNVIHLLQTIGKLYIEGCTPDIKALYPKVELPVSAGTPMLSQLV
KWMHLQEWYVPKPQSTEIITCAVCEHFISVHDKEHSYLRGNIAQGKMIYPIGGILVLVWD
TLCMSMLLPKKKVSVKFSDVHIEVQPILCEEKILRLRVAINKGNGRFEVTNAGSKVASGI
IFTTSKNVINKMDHAVTSMELNKNDVYQLLWEKGYSFSEEFRLIKSANTTLSEAIVEWRD
NWVTLIENMLQLNILNQNDNGVSLPAKISDVILNIFEHEKPIFSKDSSSTLKVIRCGGVI
LKGIRFRQIPRISYPTSLLVPSSKDKTELIKLKIQTSSCSNTMLLSAEPGNINSIHWSQV
FEPSGSGILVKVHYASLTPIDGEKATGAVSHQVNEICYGMDYSGVTESGHRVMGIVHRGA
CRNYLRAHPDLLWPVPDHWSLEDAATVPLAYAYAFYCLMIKAKLYSGMKILIHEGAGALG
QAAISIALAHKCQVFTTVGDVRMKSFLKKLYPELKEQHIGNSRDVTFGDMVLSATNGKGC
DIVICSVEPWLKHVSLQCGGALSIIIDTAQMYNQNKFELRMNSLINDRSYVIADFVSMFD
FAKNEEFKKLQILVSGGISKGYVRPLGRVTYAADEAPRALRLLSKSWHRGHVLLRLTDRA
LPASLRINCTSKCSHLIIFSDEYFGIQLAKRLINRGARMLHICCSKPSWYLQHQTENLKS
LGVNVIVSSNNLNDLDDVATVLKKTIAMGPVEGVYLTSFKDMDNKYISNSLEYLDVMSRK
FCPSLKYFAVITNSENVGKQTSIFRAKDNLVISRIEVQKPDFCGDTNTEVLLDRRAWDLS
LLGAVETGLCSKLPLLVAQIKTETLPLYQQLADVADLPLLKEAGDMTTLQDLAAGSDNIK
LIKEFLRLKYHVCISEHNVLKLNKQK
NT seq 5121 nt NT seq  +upstreamnt  +downstreamnt
atggtggactcgcagaagtcaagtatcgtcttgcaagactcatcgctaccgagcatcata
gacacgacgatcgcgagtcgcagcagaccctggtataacaatgccagtaggaatgctgta
cacctgaagcggtccgcatacgcggcatggggtggtttccaggagaggtcgagatcctca
cgtttcgccagcgtttcacaaagccgcctcaatggaaccagctcgttaattgatgtaaat
aatgaattaactttgcaattcgttcctgcagtagagttcaaggtaaatcctgtaacatca
gagaacagtccttggttgtatacaccactagaaattggcccgtattcaggaaaagcccca
ggatcacaatatttcgatgcacaatttttcaaagtacatcaacgacttggagaaaaaatg
gacgttatgtcgaggaagttgttggagcaatcttaccaagctatttacgacgccggtctg
agccctcagagcttaaatggtaaaaatgttgccgtctacataggtacttctatttctgag
acagaaataactggatttcttgatacatcttccaagagaggttttggaataatgggatgt
agtaaaacaatgttcgcaaatcgtatctcctattggctaaatgtaaaaggtccttccatg
gccgtggaccaagcatgttgcagctctatgagtgctctacagctggcatatcttgccatg
aaaagtaatgaatgtgaagctgccattgttggaggatgtcatttgagtatgctgcctgaa
tcatcagttcattacaacagaataaacaagatagcaaaagatggaaagactaggtcgttt
gatcaagaggccaacggatgtgttctctctgatgctatcaatgttattttcttgcaaaaa
gcgagtgatgctttgagggtatatgctgatgtggtccatgctaagaatgaatacatttct
ttgaaacaagaaaatgagtttccgaagagcggatcatataggaaaccgcatgaaattgca
aattatttaaaagatttttatatagaagcggatttcgccccacaagatgtcgactacgta
gaggcatttggcatcggtaatccggaatcagataaatctgaactagaagctttaactgat
gttttctgtgacaagaaaactaatccattgtatgtaggcagcgtgatgtccaatataggt
tttaccgcagcggctagtggcattacatccattataaaagacttagccaaatataaatcc
agcataccacacctggtgacagtatcagggagacaagatagttcagtaaaaaaagtactt
gataatttaaaatcaagaccaatagatccagaagaactaacattatttcacaacatacat
tcggtggtgactccagggcacttgggaagaggctacacaattttgcaaacgcaagagaat
caaacagtaagtttaggagaagcagtgaactatttcgataatgccaaacgtccgttgtgg
tttgtgtacagtgggatgggttctcaatggcctgggatgggcgcggaacttatgaatatc
ccaatattttccgcagctattgagcgctgccaaaaagcagtcgaatctaaaggaatagac
ctcgtgaaaattataacgtctactgatcctgatattttcaataatattctaaacgctttc
ttgggtatcgcggccattcagatcggtttgacagatgtcacctatgcacttggtttggtt
cctgataatatcattggacacagtgtgggcgagctcggctgcgcttatgccgatggttgt
ctaacagcagaggaaatgattttggctgcgtattctcgtggtcaagcatccattgagact
aaactcatcaagggttctatggcggccatcgggatgggatacaaacaaatcttacctctg
tgtcctccagaagtagacgtggcgtgtcacaacggaccggactctagcactatatcgggc
ccagcggatgtgactgcccatttcgtagccgaactgtcagccaaaggaatatttgctaaa
acagttccttctgcgaatatcgcgtatcactctcgttacatagctgctgctggctccaac
ctcttacaaatgctgaagaaggtcataaaaaatccacgtcttcgtagtgaacgttgggtt
tccacgtctgttcctcaagaggattggaataatgcagcagccaaatactgttcccctgaa
taccaaactaataatttgttgaacccagttctattcgaggaaacatctcgacttatccca
aacaacgccattctcatagaaatagctccacgtggactgctacaggccattctgaaacgt
tcagtatcaccagattgctttaatatatcgttaactaaaaaaggagatggtaacgtcata
catttacttcaaaccattgggaagctatacattgaaggatgcacaccagacatcaaggct
ttgtacccaaaagtagagttaccagtttcagcagggactcccatgctatcacaattagtt
aaatggatgcatctacaggaatggtacgttccaaagccacaaagtactgaaataataact
tgtgcagtctgcgaacatttcatatctgtgcatgacaaagagcatagttatttaagagga
aacattgctcaagggaaaatgatatatcctattggaggaattttagttctagtttgggac
acgttatgcatgtcgatgctattgcccaaaaagaaggtgtcggttaaatttagcgacgtt
catatagaagtgcaaccaatactttgcgaagaaaaaatattaagactgcgtgtagcgatc
aacaagggaaatggacgatttgaggttacaaacgctggatctaaagttgcaagtggaatt
atttttactacaagtaaaaatgtgattaacaaaatggatcatgcagttacttctatggaa
ctaaataaaaacgacgtatatcaactactatgggaaaaaggatactctttcagcgaagaa
ttccgtttgataaagagtgcaaatacgactttatctgaagccatcgtagaatggcgagac
aactgggtgacgctgatcgagaatatgctgcaactgaatatcttaaatcagaacgataat
ggtgtttcactacctgctaagatctctgacgttattcttaatatttttgaacacgaaaag
ccaatattttcaaaagatagttcatccacattaaaagtaattcgatgcgggggtgtgatc
cttaagggtatacgatttcgtcaaattcctagaatttcatatcccacgagtctgttggtt
ccgtctagcaaagacaaaactgaattgataaagttgaaaatacaaacttcctcttgttca
aatacgatgcttctaagcgcagaacctgggaatataaattccattcattggtctcaagtc
tttgaaccatctggatccggaattcttgtgaaggttcactacgcaagtcttactcctata
gatggtgaaaaggcaacaggagcagtatctcatcaagtgaacgaaatctgttatggtatg
gattacagcggtgttactgaaagtggacatcgtgtgatgggtatagttcatcgaggtgct
tgtcgaaattatcttcgagctcaccctgatctgttgtggccagtcccggatcactggagt
ctcgaagatgcagcaactgttcctttagcttatgcgtatgctttttactgtctaatgatt
aaagcaaaactttattcgggtatgaaaattttaatacacgaaggagctggagcactcggc
caggctgccatatccattgctcttgcacacaaatgtcaagtgttcactacagttggtgac
gtgagaatgaaaagtttcttgaaaaagctctatccagaattgaaagaacaacacattggg
aattctcgagatgtgacttttggtgacatggtactatcagcaacaaatgggaaaggttgc
gatattgtaatatgtagtgtcgaaccctggctcaaacatgtttcacttcaatgtggtgga
gctttaagcattataattgatacggcacaaatgtacaaccagaataagttcgaattgcgt
atgaatagtctgatcaatgatagatcctatgtgattgccgattttgtgtccatgttcgat
tttgcgaaaaatgaagaatttaaaaaattacaaatcctcgtgagtgggggcatctccaag
ggctacgtgcgaccactagggcgagtgacttatgctgcagatgaagctccacgagctcta
cgcctgttatcgaagagttggcatcgaggacatgtccttttaagacttacagatcgagcg
cttccagctagccttaggattaactgtacttctaaatgcagccatttaatcatcttcagc
gacgaatattttggtattcagttggcaaaaaggcttatcaatagaggtgccagaatgtta
catatctgttgttcgaagccttcgtggtatcttcaacatcaaacagaaaatcttaaatct
cttggagtgaatgttatcgtttcttcaaataacttaaatgatttggatgatgttgcaacc
gtgctaaagaaaactatagcaatgggaccggtagaaggcgtatatttgacgagcttcaaa
gatatggacaataaatacatatcaaatagcttggaataccttgatgttatgtcacgaaaa
ttttgcccatccctcaaatattttgcagtgatcacaaatagtgaaaacgtcggaaaacaa
acgtcgattttcagagcaaaggataatttagttatttcacgtattgaagttcaaaagcca
gatttttgtggggatacaaatactgaagtactgttagacagaagagcttgggatctatcg
cttttaggcgcagtcgagacaggactttgctccaagcttccattgttggtcgcacaaata
aagactgagacgttgccgctgtatcaacagcttgctgatgtcgctgatcttccattatta
aaagaggctggcgacatgaccactctacaagatttggctgctggaagtgacaatataaaa
ttaattaaggaatttttacgtctgaaatatcacgtttgtatttcggaacacaacgttttg
aagttaaataaacaaaagtaa

DBGET integrated database retrieval system