KEGG   Bombyx mori (domestic silkworm): 101743831
Entry
101743831         CDS       T02817                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor04013  MAPK signaling pathway - fly
bmor04214  Apoptosis - fly
bmor04215  Apoptosis - multiple species
bmor04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    101743831
   04391 Hippo signaling pathway - fly
    101743831
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    101743831
   04215 Apoptosis - multiple species
    101743831
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 101743831
NCBI-ProteinID: XP_004927798
LinkDB
Position
13
AA seq 224 aa
MNIRAGVMQGDITKLCVLVATLALGKVWGEGLCERGRSFWDQKNQACTPCTHCDPTLRLV
VKYPCEVYRDTICQSIYELGIWPFESAQGDTKDNDVSDDEYYEYTDYDSEVSKDNDGEVT
WDLQTTSLTLAASGCVVFFLVVLVMSLYHAKQWKVIKRALKSDVQDLTAKLKLMESGGDA
PAEPVVTTDHHLYCNIHLGKEALLGTTPTKKGTGNVYTQEKHPS
NT seq 675 nt   +upstreamnt  +downstreamnt
atgaatataagggctggggtaatgcaaggagacataacaaagttatgtgtgctagtcgct
acactggcactgggcaaagtatggggcgaggggttgtgtgagcgggggcgtagcttttgg
gaccagaagaaccaggcttgcaccccgtgcacgcactgtgacccaaccctgcgcctcgtt
gtcaaatacccatgtgaagtgtaccgggataccatctgccagtccatctacgaactaggg
atatggcccttcgaaagcgctcagggtgatactaaagacaatgacgtcagtgatgacgaa
tactacgagtacacggattatgatagtgaagtgagtaaagataacgatggtgaagtgacg
tgggacctacagactaccagtttgaccctggccgccagtgggtgtgtcgttttctttctc
gtggtgctagtaatgtcactgtaccatgccaagcaatggaaggtaataaagcgggcgctt
aaatcagatgttcaagacctcactgctaagctaaaactcatggagtccggtggagacgcg
cctgcggaacccgtagttactactgatcatcacttatactgtaatattcacttaggaaaa
gaagctctgcttggtacaacaccaaccaaaaaaggcacgggcaacgtgtacacacaagag
aagcatccgtcttga

DBGET integrated database retrieval system