KEGG   Bombyx mori (domestic silkworm): 101744138Help
Entry
101744138         CDS       T02817                                 

Definition
(RefSeq) probable alpha-glucosidase Os06g0675700
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00052  Galactose metabolism
bmor00500  Starch and sucrose metabolism
bmor01100  Metabolic pathways
bmor04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101744138
   00500 Starch and sucrose metabolism
    101744138
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101744138
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmor04147]
    101744138
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101744138
Exosome [BR:bmor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101744138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Lyase_catalyt CDC45 Trefoil NtCtMGAM_N PTPRCAP PGA2
Motif
Other DBs
NCBI-GeneID: 101744138
NCBI-ProteinID: XP_012548784
LinkDB All DBs
Position
Un
AA seq 859 aa AA seqDB search
MIPHAPKPLNETQEDDYEFEYEKTKQIRWYDKILLNRPIKVILISLVVAVVAPVLIYRFL
FFTSIDLPPADGFSFGSCLVARTLRLPCGYANVNSEQCHPHCCYDFRSKTCFHRFPSRFS
YVMDRVWDEDVVLSARVATIPFSFQNSLPRIKLSIDEVSKSHLSLNFYNPALVEIPHGNR
LEEKNYFYDVASPELNVVVNSTERMIFNTNRGPLVASQNIWELTFWLTNESMYGLGEIPL
EKTTKVLYNHNGGISGIPLIFAKSGHSYHGILIEAVAPTVITIRKENQIVLRSITSLGVK
LHLFVGPKPADIMRDVRNLLGVNKRMEYWMFGAHICSETTPNTALTVTQLNNFINTLGRQ
NVPFDSHCGVSPIIWDNDCTRAKITLVNNGARAVRNARKRFIPHMKPYVHYKNISLEFIQ
KMWVYNLPIDGMLLEDTWPLDESDKKVDNMQNYLPYFNKYLEAAFNHTPKWNATRTDGKI
YMHNHNEYGNYYVDSLKEVLGEVPTFTSSQFLSGKIIINRQNVSTTWSGLHREITEAALG
GASGNWLWSSPICGDTEHLEINTHNNLCVKWYMAATYMPMIKIHSRDGGRDPLSFEGTHR
TLMINAMRTRISLAPYFYTVLQNGPLLRPMFFQYPEIDQLKDTSTQFSVGNDLLIVPNLQ
PSQSHVHVWLPSESWYELWSGLKIEGNVGDAVTMTTTESDFLTMVRAGSIIVLQKDVTLT
AVDTRLRSQYSLTIALKCSNETLIDETEEEDEEEGEDEEEEGEDKVDEGEETVRKQHRMK
QKEVIEEEADENEEEKNTETDIKCHAKGELFMSESMTMIFKADDKSLTIQAEGEDFDILC
KPSEVVVFDLLLKDVPDKA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgataccgcacgcaccaaaacctttgaacgagactcaagaagatgattatgaatttgaa
tacgagaaaactaaacagatcagatggtacgataaaattttgctaaacagaccaattaaa
gtgatattaatttcgttggtagtagccgttgttgctccagttttgatctaccgattccta
ttcttcaccagcattgatttacctcccgcagatggtttttcatttggctcctgtctcgta
gccagaactttaagactgccgtgcggctatgctaatgtgaactccgagcaatgccatcca
cattgctgctatgactttagaagcaaaacttgcttccatagattcccatcaaggttctcc
tacgtcatggatcgagtgtgggacgaagacgtcgtcttatcagccagagtagcgaccatt
ccgttctcgtttcagaatagcttaccaagaatcaaactgtcaattgacgaggtatccaaa
agtcatttatcgttaaacttttacaatccagcattagtcgaaatacctcacggtaacaga
ttggaagaaaagaattacttttacgatgtagcttcaccagaattgaacgtggtagtaaat
tctactgaaagaatgattttcaatacgaacagaggtcctcttgttgcatcacaaaacata
tgggagctaacattttggttgacaaatgaatctatgtacggcctgggcgaaataccattg
gaaaaaacaactaaagttctttacaatcataacggcggaatcagtgggattccattaatt
ttcgcaaagtcaggtcatagttaccacgggatattgatcgaggcagtagcacccactgtt
ataacaattcgaaaagaaaaccaaatcgtactccggagtataacaagtttgggagtgaaa
ttacatttgtttgtgggtccgaagcctgcggacataatgcgagatgtaaggaatttactc
ggagtaaataaacgaatggagtattggatgttcggagcccatatctgcagtgaaacgaca
ccaaacacagctctgaccgttacccagctcaataactttataaataccctcggtcgtcag
aacgtgcccttcgatagtcactgtggtgtttctccgatcatatgggataacgattgcact
cgtgcgaaaatcactctcgtcaacaacggcgctcgagccgtgaggaacgccaggaaacgt
tttattccacacatgaagccatacgtgcattacaaaaatattagtctagaattcattcag
aaaatgtgggtgtacaatctaccaatagacggaatgctattagaagatacatggcctttg
gatgaaagtgataaaaaagtcgataacatgcagaattaccttccatattttaataagtat
ctagaagctgcttttaaccatactccaaaatggaacgcaactcgcacggatggcaaaata
tacatgcataaccacaatgaatacgggaactattacgttgattctctaaaagaagttcta
ggagaagttcccacgtttacatccagtcaatttttaagcggcaaaatcataattaaccgt
caaaatgtctccactacttggtctggtctacatcgagaaatcacagaagcagccttggga
ggtgcatcaggcaattggttatggtcgtctccgatttgcggggacaccgagcatttggaa
atcaacacacacaataatctgtgcgtgaaatggtacatggcagcaacttacatgccaatg
ataaaaattcattccagggatgggggcagagacccattatcttttgaagggacccatagg
actttgatgataaatgccatgagaacaagaatcagtttagccccttacttctacactgta
ttacagaatgggcctcttctcaggccaatgtttttccaatacccagaaatagatcagcta
aaggataccagcacacagtttagtgttgggaatgacttgttaatagttccgaatttgcaa
ccatcacaaagtcacgtacatgtttggttgccgtccgagtcctggtatgagctatggagt
ggtttaaaaattgaaggtaacgtaggagacgcagtaactatgacaacaacagaatctgac
ttcttaactatggtacgtgcaggatctatcatcgttttgcagaaggatgtaacactaact
gctgttgatacgcgccttcgttctcaatattctcttacaatagctcttaaatgtagcaat
gaaacattaatcgatgagacagaagaggaagatgaagaagaaggggaagacgaagaagaa
gaaggagaagacaaagtagacgaaggtgaagaaacagtgaggaaacaacacagaatgaaa
caaaaagaagtcatagaggaagaggccgatgaaaatgaagaagaaaaaaatacagaaact
gacataaaatgccatgctaaaggagaattgtttatgtctgaatcaatgaccatgattttt
aaggccgatgacaagagccttacaatacaagcagaaggagaagattttgatattctttgt
aaaccgagtgaagttgttgtttttgatcttttgctgaaagacgtaccggacaaggcatag

DBGET integrated database retrieval system