KEGG   Bombyx mori (domestic silkworm): 101744970Help
Entry
101744970         CDS       T02817                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00020  Citrate cycle (TCA cycle)
bmor00190  Oxidative phosphorylation
bmor01100  Metabolic pathways
bmor01200  Carbon metabolism
Module
bmor_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmor_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bmor_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101744970
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101744970
Enzymes [BR:bmor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101744970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2
Motif
Other DBs
NCBI-GeneID: 101744970
NCBI-ProteinID: XP_004922687
UniProt: H9JI58
LinkDB All DBs
Position
Un
AA seq 294 aa AA seqDB search
MPKLSERFHKIIRFSFRNYSSKTETKPKKDVDPCRTFKIYRFGGILSKEQPKIQSYELDV
STCGKMVLDALIKIKDKDPTLTFRRSCREGICGSCAINLQGMNCLSCITEIPPAKTITIL
PLPHMYVIRDLVVDMTHFFNGYDSIRPYLVRKNDGAIGKTQLAQSIKDNEKMVGLYECVL
CSCCSTSCPSYWWNGRRFLGPATLLHAYRWVIDSRDDDTEQRLYELRDSFKAFKCHTIMN
CSLACPKGLHPAKAIMNLKRLISGLDKKPVPEIDPGKFKSGGDSGSGKNKKCCP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaactaagcgaacgatttcacaaaatcatcagattctctttcaggaactatagt
tcgaaaacagaaacgaaaccaaagaaagacgtggacccttgtaggacgttcaaaatatat
cgcttcggaggtattctttcaaaggaacaacccaaaatacagagctatgaactagacgtt
tcaacatgcggcaaaatggttctagacgctttaattaaaataaaagacaaggacccaact
ctgacgttccggagatcctgtcgtgaaggtatctgcggctcttgtgcgatcaacttacaa
ggaatgaactgcttgtcctgcatcactgagatacctccagccaagaccatcaccatactc
ccattaccccatatgtatgtcatcagagacctggtggttgacatgacacattttttcaat
ggctacgatagtattcgaccgtatcttgtgaggaaaaacgatggagccattggaaaaact
cagttagcccaaagcatcaaagacaatgagaaaatggtcggattatatgagtgcgttttg
tgctcatgctgttctacatcgtgtccgagttactggtggaacggcaggaggttcttaggc
cccgccacgttactccatgcgtatagatgggtcatagattcaagagacgacgacacggaa
caaagactgtatgaattacgggacagtttcaaagcattcaaatgtcacaccatcatgaac
tgctcgttggcttgtcccaaaggcttacatccagcaaaggctattatgaacctaaaaaga
ctaatttcaggcctagacaaaaaacctgttccagaaatagatcctggcaagttcaagtct
ggcggagacagtggcagtggcaaaaacaagaaatgttgcccatga

DBGET integrated database retrieval system