KEGG   Bombyx mori (domestic silkworm): 101745054Help
Entry
101745054         CDS       T02817                                 

Definition
(RefSeq) hexokinase type 2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00010  Glycolysis / Gluconeogenesis
bmor00051  Fructose and mannose metabolism
bmor00052  Galactose metabolism
bmor00500  Starch and sucrose metabolism
bmor00520  Amino sugar and nucleotide sugar metabolism
bmor01100  Metabolic pathways
bmor01200  Carbon metabolism
Module
bmor_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bmor_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101745054
   00051 Fructose and mannose metabolism
    101745054
   00052 Galactose metabolism
    101745054
   00500 Starch and sucrose metabolism
    101745054
   00520 Amino sugar and nucleotide sugar metabolism
    101745054
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101745054
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bmor04131]
    101745054
Enzymes [BR:bmor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101745054
Membrane trafficking [BR:bmor04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101745054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 101745054
NCBI-ProteinID: XP_004932650
LinkDB All DBs
Position
Un
AA seq 474 aa AA seqDB search
MLAAVRSTFAGICSKSKKTNSMCANDLIHSRIREECEVLKMTDKQIKEIMCRLHNDLKKG
LSRADHDKATVKCWITYIQDLPNGKERGKFLALDLGGTNFRVLIINLGENHFDMQSKIYA
IPKHIMTGTGIALFDHIAECLPNFMKEHGVYEERLALGFTFSFPLKQLGLTKGVLQRWTK
GFSCSGVVGEDVVQGLKDAIARRGDVQIDICAILNDTTGTLMSCAWKNHNCKIGLIVGTG
SNACYVEKTANCELFDGEPDKEELLINTEWGAFGDDGSLDFVRTEFDREVDVTSINPGKQ
IQEKMISGMYLGELVRLALVKFTRMGLLFGGQGSDLLFEGGSFYTKYVSEIESDKPGDFT
SCMEVLEELGLSHASDADMAAVRYVCECVSRRAAHLVSAGIATLLNKMNEPRVTVGIDGS
VYRFHPHFHTLMCEKIAQLVRPGLQFDLMLSEDGSGRGAALVAAVACREAEQGS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgttggcagcggtaagaagtacgttcgcgggtatctgctcgaaatcaaagaaaaccaac
agtatgtgtgccaacgatttgattcattccaggattcgcgaagaatgcgaagtcctaaag
atgaccgacaaacaaatcaaagaaataatgtgcaggcttcataacgatttgaagaaaggg
cttagccgcgctgatcatgacaaagctacagtaaagtgctggatcacatacatacaagat
ttacccaacggaaaagagagaggtaaatttttggcattagatttaggtggaacgaatttc
agagttttaataataaatttaggggaaaaccattttgatatgcagtccaaaatctatgcc
ataccaaaacatataatgactggcaccggcattgctctatttgaccacatagccgaatgt
ttaccaaattttatgaaggagcacggagtttatgaagaaagattggcacttggatttaca
ttcagttttccactaaaacaactgggtcttacaaaaggcgtattacaaagatggactaaa
ggtttctcttgttccggtgtggtcggcgaagatgttgtacagggccttaaagatgctatc
gccagaagaggggatgtacagattgacatatgcgctattctgaatgatacaaccggtaca
ttgatgtcctgcgcatggaaaaaccacaactgcaaaataggactcatcgttggtactggc
agcaacgcttgttacgtcgagaaaacagcgaattgtgagctgttcgatggcgaacctgac
aaagaggaactgctcattaataccgagtggggggcgtttggggatgacggcagcctcgac
ttcgtgcggaccgagttcgatagagaagtagacgtcacatccataaaccctggcaaacaa
attcaagagaagatgatttctggcatgtacctgggtgaattggtgcggctggcgctcgtc
aaattcactcgaatgggcttgctgttcgggggtcaaggttcggatcttctgttcgaaggg
ggcagcttctataccaaatacgtgtctgaaattgaatccgataaacccggagacttcacc
agctgcatggaggtcttggaagaactcggtttgtctcacgcgtctgacgcggacatggcg
gcggtgcgctacgtgtgcgagtgcgtgtcgcggcgggcggcgcacctcgtgtcggcaggc
atcgcgacgctcctcaacaagatgaacgagccgagggtcaccgtgggaatcgacggctcc
gtataccgcttccatccgcacttccacacgctaatgtgtgagaagatcgctcaacttgtc
cgacccggactacagttcgatctcatgttatccgaggacggcagcgggcgtggcgcagcc
ctagtggcagcggtggcgtgccgggaagcggaacaagggtcgtag

DBGET integrated database retrieval system