KEGG   Bombyx mori (domestic silkworm): 692400Help
Entry
692400            CDS       T02817                                 

Definition
(RefSeq) ecdysteroid-inducible angiotensin-converting enzyme-related gene product
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bmor01002]
    692400
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmor04147]
    692400
   04090 CD molecules [BR:bmor04090]
    692400
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     692400
Peptidases [BR:bmor01002]
 Metallo Peptidases
  Family M2
   692400
Exosome [BR:bmor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   692400
CD molecules [BR:bmor04090]
 Proteins
  692400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 TTSSLRR Cytokin_check_N
Motif
Other DBs
NCBI-GeneID: 692400
NCBI-ProteinID: NP_001036859
UniProt: Q9NDS8
LinkDB All DBs
Position
Un
AA seq 648 aa AA seqDB search
MLKVGGGAVLIAAIVAVFIVATQGRDPDLEAREHEAREYMLHLDKATGLRKNRASLAEWE
YTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYSQLGVAALP
DDKFQALMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEW
HNAAGATAKKNFTDYVNLYNEAAKLNGFDNVAEWWQSEYEVPDFEEQLAKLWEDVKPLYQ
QLHAYVRKRLRDKYGDKVVSARGPIPAHLLGNMWAQTWNNIESFTRPYPDKKEIDVTQAM
RDQNYTPMKMFQMSDEFFRSLNLTAMPEKFWKNSIIEKPTDREIVCHASAWDFFDGEDFR
IKQCTTVDYEYFQTTHHEMGHIQYYLQYRDQPVVFRDGANQGFHEAVGDTIALSVSSPKH
LRRVGLATGDAEDEQTEINQLYKMGIDKIAFLPFAYTLDLFRYGVFRRKTLPEDYNCHYW
KLREQLQGVEPPVNRTEDDFDAAAKYHVSSNVEYARYYVSFIIQFQFHRGVCQLAGEHAA
GDPNKKLVDCDIYQSVAAGNALANMLKMGSSKPWPDAMEALTGQREMKADGLLEYFRPLH
DWLRAENQRTGEHIGWEPTNMEYCTPSQLSELNVKEPSSSPATQQSDS
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagtggggggcggtgcggtattgatcgcggcgatcgttgccgtgttcatcgtg
gccacgcagggacgagacccggacctcgaggcgcgggagcacgaggcgcgggagtacatg
ctgcatctggacaaagcgaccggcctgaggaagaacagggccagcttagccgaatgggag
tacacctcgaatatcacgaaggagaacgaagagaaatcgatacaaactcacctggagctc
tcccgtcaagagaaagcagcctgggaggagaccaagatgtacgggtggcaggacttccag
gatttcacgttgcgtagaatgttcaagaaatacagtcagctgggcgttgcggctctgcct
gacgacaaattccaagctttgatgagaactgtatcgggaatggaatcgaattacgccacc
gcgaagatctgctcgtacaagaatgagagtaaatgcgatctatctttggagcctgagata
actgagatattctccacgagccaagaccctgaggagttgaaacatgcctgggtggaatgg
cacaacgcggccggtgcgacagcgaagaagaacttcactgactacgtgaacctttacaac
gaggccgccaagcttaatggcttcgataacgtagccgaatggtggcaatcagaatacgag
gtaccggacttcgaggagcagctggcgaagctgtgggaggacgtgaagcctctgtaccag
cagctgcacgcctacgtcaggaagaggctgcgggacaagtacggagacaaggtcgtgtcc
gccagaggaccgataccggcgcatttactgggcaacatgtgggcccagacgtggaacaac
atcgaatccttcactcgtccttatccggacaagaaggagatcgacgtcacacaagcgatg
agagaccagaactacactccgatgaagatgtttcaaatgtcagacgaattctttaggtcg
ttgaacttgaccgctatgcccgagaagttctggaagaactctataatagagaagccgacg
gatagagaaatcgtttgtcacgcctccgcctgggacttctttgatggcgaagattttagg
atcaaacagtgcacgacagtcgattacgaatacttccagaccacccaccacgagatgggg
cacatccagtactacctgcagtaccgggatcaacccgttgtgttcagggacggagcgaac
caaggtttccacgaagcggtcggggatacgatagctctctcggtgtcgtctccgaaacat
ctgcgtcgggtcggactggccacgggcgatgccgaggacgaacagacagagatcaatcag
ctttataagatgggaatagacaagatcgcattcctaccgttcgcatacaccctggacctg
ttccgatacggtgtgttcagaaggaagacgctgccggaagactacaactgccactactgg
aagctaagggagcagctacaaggcgtggagccgcccgtcaatagaactgaggacgacttc
gacgccgcagccaagtaccatgtgtcttccaacgtcgaatacgccagatattacgtgtcg
ttcataatccagttccagttccaccgcggcgtgtgccagctggcgggcgagcacgcggcc
ggggaccccaacaagaagctggtcgactgcgacatctaccagagcgtcgccgccgggaac
gcgctcgcaaacatgctgaagatgggttcgtctaagccctggccggacgcgatggaggcg
ctgaccggacagcgggagatgaaggcggacggcctcctggagtacttccggccgctccac
gactggctgcgggcggagaaccagcggaccggcgagcacatcggctgggaaccgaccaac
atggagtactgcacgccgagccaattgtcggagctaaacgtgaaggagccgtcgtcgagt
ccagcgacgcaacaatctgactcttga

DBGET integrated database retrieval system