KEGG   Bombyx mori (domestic silkworm): 692746Help
Entry
692746            CDS       T02817                                 

Gene name
VDP
Definition
(RefSeq) vitellin-degrading protease
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    692746 (VDP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bmor01002]
    692746 (VDP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmor04147]
    692746 (VDP)
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     692746 (VDP)
Peptidases [BR:bmor01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   692746 (VDP)
Exosome [BR:bmor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   692746 (VDP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 692746
NCBI-ProteinID: NP_001037317
UniProt: Q07943
LinkDB All DBs
Position
Un
AA seq 264 aa AA seqDB search
MTNSLLICFTILGLAASSPTKPIGDIRIVGGEDIVITEAPYQVSVMFRGAHSCGGTLVAA
DIVVTAAHCVMSFAPEDYRIRVGSSFHQRDGMLYDVGDLAWHPDFNFASMDNDIAILWLP
KPVMFGDTVEAIEMVETNSEIPDGDITIVTGWGHMEEGGGNPSVLQRVIVPKINEAACAE
AYSPIYAITPRMLCAGTPEGGKDACQGDSGGPLVHKKKLAGIVSWGLGCARPEYPGVYTK
VSALREWVDENITNLRLKHILRRF
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattcacttttaatatgcttcacgatcttaggtttagccgcctcatcccccaca
aaacccatcggggatataaggatcgtgggaggtgaagacatcgtcatcacagaggcgccg
taccaagtatcagtcatgttccgaggagcccattcttgcggtggaaccttagtcgctgct
gacatcgttgttactgccgcacactgtgtcatgagttttgctccagaagactacaggatc
agagtaggatcttccttccatcaacgagatggaatgctttacgatgtaggagatctagct
tggcacccagatttcaattttgcgtcaatggataatgatatcgccattttatggttgcca
aaaccagtcatgttcggggatacagtggaagctatcgagatggtagaaactaattccgag
atccccgatggagatattacaattgtaactggatggggccatatggaggaaggcggtggt
aacccttctgttcttcaaagagttatagtccctaaaatcaacgaagctgcgtgcgccgag
gcttactcaccgatttacgcaataacccccagaatgctatgcgctggaacgcctgaaggt
ggcaaagacgcgtgtcagggtgacagtggtggtcctttggtccataaaaagaaattggcc
ggcatcgtttcttgggggcttggctgtgcgagaccagaatacccaggggtctacacgaag
gtgtccgcgctaagggaatgggtcgacgaaaacataaccaatctgagactgaagcatatt
ttaaggagattttaa

DBGET integrated database retrieval system