KEGG   Bombyx mori (domestic silkworm): 733025Help
Entry
733025            CDS       T02817                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00040  Pentose and glucuronate interconversions
bmor00051  Fructose and mannose metabolism
bmor01100  Metabolic pathways
Module
bmor_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    733025
   00051 Fructose and mannose metabolism
    733025
Enzymes [BR:bmor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     733025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C UDPG_MGDP_dh_N Pyr_redox_3 ADH_N_2 Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 733025
NCBI-ProteinID: NP_001037592
UniProt: Q1ET59
LinkDB All DBs
Position
Un
AA seq 358 aa AA seqDB search
MATDNLTALLYKPNDLRLVQTPIPEISEDEVLLRMDCVGICGSDVHYWQKGQCGHFVLEE
PMIMGHEASGVVAKIGSKVKNLTVGDRVAIEPGVPCRYCEFCKTGRYHLCPDMIFCATPP
VHGNLVRYYKHAADFCFKLPDHVTMEEGALLEPLAVGIHACKRGGVSAGHVVLVLGAGPI
GLLTMLTAKAFGAHKVLIIDILQSRLDFAKSLGADYTLLIGKDSNEAELVRKIHEILEGH
PDVSFDASGAQATVRLALLATKSGGVAVLVGMGAPEQTVPLAGALSREVDIRGIFRYVND
YPTALAMVASGKINVKPLVTHHFSIEESLEAYEVARQGAGIKVMIHVQPRDTNNPQKF
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggccacagataacctaaccgctttgttgtacaaaccaaatgatttgcgtttggtacaa
acaccgatccctgaaatatctgaagatgaggtcctgctgcgcatggactgcgtgggtatc
tgcgggtcagacgtccactactggcagaagggtcaatgcggacacttcgtgctggaagaa
ccaatgatcatgggacacgaagcttcaggagtagtggccaagatcggttcgaaagtcaag
aatctgacagttggtgatcgagtggccatagagcccggcgtgccgtgtcggtactgcgag
ttctgtaagacaggacgataccacctatgccctgacatgatcttctgcgccacgccccca
gtacacggaaacctcgtcagatattacaagcacgcagctgatttttgcttcaagcttcct
gatcacgtgaccatggaagaaggagcgctactggagcccctcgcggtgggcattcacgcg
tgcaagaggggcggagtctcggcgggacacgtggtgctggtactgggagcgggacccatc
ggtctccttaccatgctcacagctaaagcctttggagcacacaaagtactcataatagat
atccttcagagccgtttggatttcgccaagtcgttaggcgccgactacacacttctcata
ggcaaggactcgaacgaggctgagctggtgaggaagattcatgagatactggagggacac
cccgacgtgtcgttcgatgcgagtggggcccaggccacagtcagattagcgttactggcc
acgaagtctggcggcgtggcggtgctggtcggcatgggagcgcccgagcagaccgtgccg
ctcgcgggcgccctctcgcgggaggtcgacatccggggcatcttccgatacgtcaacgac
taccccactgcactagcgatggtagcgagtgggaaaataaacgtgaagccgctggtcacg
caccacttcagcatcgaggagagcctggaggcgtacgaagtggcgcgccagggggccggc
atcaaggtcatgatccacgtccagccgcgagacacgaacaacccacaaaagttctga

DBGET integrated database retrieval system