KEGG   Bacillus velezensis: NG74_00334Help
Entry
NG74_00334        CDS       T03423                                 

Gene name
nasC
Definition
(GenBank) Assimilatory nitrate reductase catalytic subunit
  KO
K00372  assimilatory nitrate reductase catalytic subunit [EC:1.7.99.-]
Organism
bmp  Bacillus velezensis
Pathway
bmp00910  Nitrogen metabolism
bmp01100  Metabolic pathways
bmp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    NG74_00334 (nasC)
Enzymes [BR:bmp01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     NG74_00334 (nasC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4
Motif
Other DBs
NCBI-ProteinID: AIU80494
UniProt: A0A563AQ43
LinkDB All DBs
Position
complement(308388..310520)
Genome map
AA seq 710 aa AA seqDB search
MTEPMLRYFRDKLQDVQSEKTYETQCPFCSMQCKMQLTEQTFAARKKYTAIGIDNPTTHG
RLCTKGMNAHQHAVHSSRITRPLLKKNGEFVPVSWAEALNRIKEQINLIQTEHGNDAMAV
YGSASITNEEAYLLGKFARVGLQTKYIDYNGRLCMSAAATAAGQTFGADRGLTNPLSDIP
HTRVIILAGTNIAECQPTIMPYFDKAKENGAYIIAIDPRETATTKIADLHLKIKPGTDAA
LANGLVKICIDEQLTDKDFIRTRTNGFNKLKRHTDALDLKEISEQTSVPLEHMRKAAVKF
AKETSGMLFTARGIEQQTDGTAAVKAFLNMVLITGKIGKPFSGYGAITGQGNGQGAREHG
QKADQLPGYRSIEIEEHRAHIAKVWGIHQDELPRKGVSAYEMIEKIDNGDIKGLFLMCSN
PAVSGPNANFVKQAIKKLRFFVAVDLFISETAAFADVILPASSYLEDEGTMTNAEGRVTL
REASRSCPGEAKHDWQIICDLASALGKGRYFSYTSAEDIFNELREASRGGIADYSGISYD
RLRREGGIHWPCPESDHPGTGRLFTESFAHPDQKAALSVIPNEPPVPKEKPTADYPLYLT
TGRVMSHYLTGVQTRKSAALAARHFESFMEIHPKTAANYHIEDRVLVKIESPRGSITVRS
RWSENVRKDTLFVPIHWSDTQNVNDLIGEALDPDCKMPGFKMCAVRISPI
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaaccgatgctccgttatttccgtgacaaactccaagatgtccaatcggaaaaa
acatatgagacgcaatgcccgttctgcagcatgcaatgcaaaatgcagcttacggaacaa
accttcgcggcacggaagaaatacactgcaatcggcattgataatccgacgacacatggc
cgtttatgtacaaaaggcatgaatgcccatcagcatgccgtgcactcttcccgcattaca
cgccccctgcttaaaaaaaacggtgaatttgtgcctgtctcttgggctgaagcactgaat
cgcataaaggaacaaatcaatctgatccaaaccgaacacggcaatgatgcgatggccgtc
tatgggagcgcctcaattacaaatgaagaagcctatctgcttggaaagttcgcacgggtc
ggcttacagacgaaatacatcgattacaacgggcggctctgtatgtctgccgcagcaacg
gcggccggccagacattcggcgcggacaggggcctgacgaatccattatcggacattccg
catacacgtgtcatcatcctggcaggcaccaatatcgcggaatgccagccgacgatcatg
ccgtattttgataaagcgaaagaaaacggggcttacattatcgccattgatccccgggaa
acggcgacgactaaaatagccgatcttcacctgaaaatcaagcccggcacagacgccgcc
ctggcaaacggactcgtcaaaatctgcattgacgaacagcttacagacaaagactttatc
cgcacacgcacaaacggattcaataagctcaaacggcataccgacgctttggatctgaaa
gagatttccgagcagacaagtgtgcctttggagcatatgcgaaaggccgccgtgaagttt
gccaaggaaacatccggcatgctgtttacagcgcgggggatcgaacagcagactgacggt
accgcggcggtgaaagctttcttaaatatggtgctgatcaccggaaaaatcggcaagccc
ttctcaggttacggggcgattaccggtcaaggcaacggacaaggcgcgagagaacacggc
caaaaagcggatcagcttccgggctaccgttctatcgaaattgaagaacaccgggcgcat
attgcgaaggtgtgggggattcatcaggatgagctgccgcgaaaaggtgtctcagcctat
gaaatgatagaaaaaatagataacggcgacatcaaaggactgtttctcatgtgttccaat
ccggctgtttccggcccaaatgcgaatttcgtcaagcaggcaatcaagaaactgagattt
tttgtcgcagttgacttatttatttctgagaccgcggcattcgcagatgtgattttaccc
gcctcctcttatttggaagacgaaggcacgatgacaaatgcagaaggccgcgtgacatta
agagaagcgagccggtcatgtcccggcgaagcgaagcatgattggcagatcatttgtgat
ctcgcatccgctctcggcaagggccgctacttttcttatacgtcagcggaggatattttt
aatgaattgagagaagcgagccgaggcgggattgccgattattcaggcatctcatacgac
aggctcagacgtgaaggcggcattcattggccgtgtccggaatctgatcatcccggaact
gggcgcttgtttacagaatcatttgctcatccggatcaaaaagcggcattaagtgtgatt
ccaaacgaaccacctgttccaaaagagaagccgacagccgattatccgctttatttaacg
acgggaagggtgatgtctcactacttaacaggcgtccaaacaagaaaaagcgccgctctt
gccgcgagacattttgaatcgtttatggaaatccacccaaaaacggcggccaactatcat
atcgaagaccgtgttctcgtgaagatagaatccccccggggcagcatcacggtccggagc
agatggtcggagaacgtacgaaaagacacgttgtttgtccccatccattggtctgacacg
caaaacgtcaacgatttaattggtgaagccttggacccggactgtaaaatgcccggtttt
aagatgtgcgcggtacgaatcagccctatataa

DBGET integrated database retrieval system