KEGG   Bacillus velezensis: NG74_00337Help
Entry
NG74_00337        CDS       T03423                                 

Gene name
yciC
Definition
(GenBank) Putative metal chaperone YciC
Organism
bmp  Bacillus velezensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cobW CobW_C RsgA_GTPase GTP_EFTU T2SSE TsaE MobB ATPase_2 AAA_30 AAA_16 dNK
Motif
Other DBs
NCBI-ProteinID: AIU80497
UniProt: A0A1D9PFL0
LinkDB All DBs
Position
314417..315619
Genome map
AA seq 400 aa AA seqDB search
MKKIPVTVLSGYLGAGKTTVLNHILQNRNGLKIAVIVNDMSEVNIDAGLVKQGGGLSRTD
EKLVELSNGCICCTLREDLLVEVEKLAKDGRFDYIVIESTGISEPIPVAQTFSYIDEEMG
IDLTTFCRLDTMVTVVDANRFWHDFQSGDSLLDRKEAAGEEDERVIADLLIDQIEFCDVL
ILNKCDMVGEKELEQLETVLRALQPRARLIRSVRGEVPAEYILNTGLFEFEEASSSAGWI
KELTAGHEAHTPETEEYGITSFVYSRRLPFHTARFDSWLHQSIPDNIVRAKGIAWCATRN
SLALLMSQAGPAVSIEPVSYWVAAMPKLEQEQIKQQEPEILEDWDDQFGDRHTNLVFIGT
DLDEAAITKELDQCLLTPSEFDSDWSQLEDPFQWDIQRAE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattccggttacagtattgagcggctatcttggtgccggaaagacgaccgtt
ttgaatcatattttacaaaaccgcaacggtttaaaaattgccgtcatcgtcaatgacatg
agcgaagtaaatatagacgcgggattggtgaagcagggaggcggcttgtcaaggacggat
gagaaactcgtagaattatccaacggctgtatctgctgcacgctgcgtgaggatctatta
gtcgaagttgagaaactcgcgaaagacggcagatttgattatattgtgattgaatcaaca
gggatcagcgaaccgattcccgttgcccagacattttcttatatagatgaagaaatgggc
attgatctgacaacattctgcaggctggacacaatggtgaccgtggtggatgcaaaccgc
ttctggcatgatttccagtccggtgacagccttcttgaccggaaggaagcggcgggagaa
gaggatgaacgggtgattgccgatttattaattgaccaaatcgagttttgtgatgtgctc
attttaaataaatgcgacatggtgggcgaaaaagagcttgaacagctggaaacggtcctt
cgcgcattacagccccgtgccagactgatccggtccgtccgcggagaagtgcccgccgaa
tacatattgaataccggtttatttgagtttgaggaagcgagttcatcagcaggatggata
aaggaactgacggcaggtcatgaagcgcacactccggaaacggaagagtacggcatcact
tcgtttgtgtactcgcggcgtctgccgtttcataccgctcgttttgacagctggctgcat
caatcaatccctgacaacattgtgcgcgcaaaaggaattgcttggtgcgcaacccgcaac
agccttgcgctgctgatgtctcaggcgggtccggcggtttcgattgagcctgtttcttat
tgggtggcggcaatgccgaaacttgagcaggagcagatcaaacagcaggaaccggagatt
ctggaagattgggacgaccaattcggagaccgtcatacgaacctggtgtttatcggaaca
gatttagatgaagcagccattacaaaggaattggatcagtgcctgctcacgccgtctgag
ttcgattccgattggtcgcagcttgaagatccttttcaatgggatattcagcgggccgaa
taa

DBGET integrated database retrieval system