KEGG   Bacillus velezensis: NG74_00385Help
Entry
NG74_00385        CDS       T03423                                 

Gene name
yclQ
Definition
(GenBank) putative ABC transporter solute-binding protein YclQ precursor
  KO
K02016  iron complex transport system substrate-binding protein
Organism
bmp  Bacillus velezensis
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmp02000]
    NG74_00385 (yclQ)
Transporters [BR:bmp02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    NG74_00385 (yclQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2 DDE_Tnp_IS1 LPAM_1
Motif
Other DBs
NCBI-ProteinID: AIU80545
UniProt: A0A235BDL7
LinkDB All DBs
Position
383523..384467
Genome map
AA seq 314 aa AA seqDB search
MKKIALLFIALVTIFVVSACGNGDKTSGKSKETITIKDDLNKEGVKVPKNPKKVVVFNFG
MLDTMDELGLQDHVAGLPKQNLPKYLSSYKSDKYANTGGLKEPDFEKVADIDPDLIIIAH
RQSDSYKEFSKIAPTIYLDDDYTNYVDRFKHNTEVIGKIFNKENEVKDKLAKIDKSIADL
KKKTSSTDKNGLVVMANDGKISAFGSKSRYGFIHDVFGVKPADKNIEASLHGQSISYEYI
AKTNPDYMFVVDRGTAIGTKSSTKQVVENDYVKSVKAVKNNHVVYLDSATWYLSGGGLES
MAQMVKEVKDGIEK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcgcattgctattcattgcgctagttacgatttttgttgtttctgcatgc
ggaaacggggacaaaacatcaggcaaatcaaaagaaacaatcacaatcaaagatgacctg
aacaaagaaggagtcaaagtgccgaagaatccgaaaaaagtcgtcgtattcaacttcgga
atgctggacacgatggatgaactcggtttacaggatcacgtggcgggacttccgaaacaa
aaccttccaaaatacttatcttcatataaaagtgataaatacgccaataccggcggttta
aaagaaccggattttgaaaaagtcgcggatattgatccggatttaatcattatcgcccac
agacaatctgattcttataaagagttctcaaaaatcgcgccgacgatttatcttgatgat
gactatacaaactacgttgacagattcaagcacaacaccgaagtgatcggcaaaatcttt
aacaaagaaaatgaagtgaaagataagcttgcgaaaattgacaaatccattgccgatctg
aagaaaaagacaagcagcacggataaaaacgggttagtggtgatggcgaacgacggcaaa
atcagcgcgttcggatctaaatcaagatacggcttcattcatgatgtgttcggcgtcaaa
ccggctgacaaaaacattgaagcctcactgcacggacaaagcatttcctatgaatatatc
gccaaaacaaaccctgattacatgtttgtcgttgaccgcggaacagcgatcggcacaaaa
tcttcaacaaaacaagtggttgagaatgattatgtaaaatcggtgaaagccgtgaaaaac
aaccatgttgtctaccttgattcagctacatggtatttatcaggaggcggcctggaatcc
atggcgcaaatggtgaaagaagtaaaagacggaatcgagaagtaa

DBGET integrated database retrieval system