KEGG   Bacillus velezensis: NG74_00963Help
Entry
NG74_00963        CDS       T03423                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bmp  Bacillus velezensis
Pathway
bmp00564  Glycerophospholipid metabolism
bmp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NG74_00963 (glpD)
Enzymes [BR:bmp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NG74_00963 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 GIDA Pyr_redox_2 NAD_binding_8 FAD_oxidored Cation_ATPase_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AIU81074
LinkDB All DBs
Position
926538..928202
Genome map
AA seq 554 aa AA seqDB search
MNHQFSSLERDHMLEDMTKKTYDLFIIGGGITGAGTALDAASRGMKVALSEMQDFAAGTS
SRSTKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHKGGTFGSFST
SIGLRVYDYLAGVKKSERRSMLSAKETLQKEPLVKKDGLKGGGYYVEYRTDDARLTIEVM
KEAVKFGAEPVNYSKVKELLYEKGKVVGVLIEDLLSGKEYKVYAKKIVNATGPWVDELRE
KDHSKSGKHLQHTKGVHLVFDQSVFPLKQAVYFDTPDGRMVFAIPREGKTYVGTTDTVYK
QKLEHPRMTVQDRDYVVSSINYMFPELNITADDIESSWAGLRPLIHEEGKDPSEISRKDE
IWTSQSGLITIAGGKLTGYRKMAEHIVDLVRDRLKEEGGQDFGGCKTKTMPISGGHVGGS
KNFESFVEAKTKDGLKIGLSQETAKQLAIRYGSNVENVFSRIEGLKDEAEKRQIPVHILA
EAAYSIEEEMAATPADFFVRRTGRLFFDIKWVQTYKTAVIDYMSDRFQWNDATKEKHTEW
LNTLLHDAVVPLEQ
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaccaattttcaagtttggaacgggatcatatgctggaagacatgactaaaaaa
acatacgatctgtttattataggcggaggtattacaggtgccggtacggcgcttgacgca
gcttcaaggggaatgaaagtcgctttgagcgaaatgcaggatttcgcggccggcacatca
agccgatccacaaagcttgtccacggcggtttgcgttatctgaagcaatttgaagtcaaa
atggttgcagaagtcggtaaggaacgtgccatcgtgtacgaaaacggcccgcacgtcacg
acgccggaatggatgctgctgccgtttcataaaggcggcacgttcggttcattctctact
tccatcggcctgcgtgtgtatgactatttagcgggagtaaaaaaatcagagcgcagaagc
atgctgtctgctaaagaaacgctgcaaaaagagccgctcgtcaaaaaagacggcttaaaa
ggcggaggctattatgtagagtaccggacggacgatgcgagactgacgattgaagtcatg
aaagaagccgttaaattcggtgcggagcctgtcaactactctaaagtgaaagaactgctt
tatgaaaaaggaaaagttgtcggcgttttaattgaagatctgctgtcaggcaaggaatac
aaagtttacgccaaaaaaatcgtcaatgcgacaggtccgtgggtcgacgagctgagagaa
aaagaccacagtaaaagcggaaaacatcttcagcacacaaaaggggtccatcttgtattc
gaccaatccgtattcccgcttaaacaggcggtgtactttgatacgccggacggccggatg
gtgttcgccattccgcgtgaaggaaaaacatacgtgggtacgaccgatacggtttacaaa
caaaaacttgagcatccgcgcatgacggtgcaggatcgcgattatgtcgtcagctccatc
aattatatgttcccggaactgaacattacggcggacgatattgaatcaagctgggccggc
ctcagaccgcttattcacgaagaagggaaagacccgtctgagatctcccgtaaagatgaa
atctggacatctcaatcaggcctgattacgatcgccggaggaaaactgacgggctaccgt
aaaatggctgagcacattgtcgatcttgtccgcgaccgcttgaaagaagagggcggccag
gacttcggcggctgcaagacgaagacgatgccgatttccggcggacatgtcggcggctct
aaaaacttcgagtcatttgtggaagcaaagacaaaagacggcttgaaaatcggtttatca
caggaaaccgctaagcagttagccatcagatacggctctaacgttgaaaatgtattcagc
cggattgaaggtctgaaagacgaagcggaaaaacgccagattccggttcacattctggct
gaagcggcttacagcatcgaagaagaaatggctgcgacacctgccgatttcttcgtccgc
agaacgggaagactgttcttcgacatcaaatgggtgcaaacgtataaaacggccgtgatt
gattacatgagcgaccgattccaatggaatgacgcaacgaaagaaaaacacactgagtgg
ttaaatacgctgctgcacgacgcggttgttccgctcgaacaataa

DBGET integrated database retrieval system