KEGG   Bacillus velezensis: NG74_01391Help
Entry
NG74_01391        CDS       T03423                                 

Gene name
dapL_1
Definition
(GenBank) LL-diaminopimelate aminotransferase
  KO
K08969  aminotransferase [EC:2.6.1.-]
Organism
bmp  Bacillus velezensis
Pathway
bmp00270  Cysteine and methionine metabolism
bmp01100  Metabolic pathways
Module
bmp_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NG74_01391 (dapL_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bmp01007]
    NG74_01391 (dapL_1)
Enzymes [BR:bmp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     NG74_01391 (dapL_1)
Amino acid related enzymes [BR:bmp01007]
 Aminotransferase (transaminase)
  Class I
   NG74_01391 (dapL_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIU81485
UniProt: A0A1D9PIJ1
LinkDB All DBs
Position
1310943..1312139
Genome map
AA seq 398 aa AA seqDB search
MNFEISDVLKQLPEQFFASLVQKVNQKLKEGRDVINLGQGNPDQPTPQHIVEEMKRAVER
PENHKYSSFRGAYSFKKAAAAFYEREYGVTLDPETEVAVLFGGKAGLVELPQCLLNPGDT
ILVPDPGYPDYWSGVALAKAKMEMMPLTEERGFLPDYSVIPEKVRSEAKLLYLNYPNNPT
GAVATEAFFEETVGFAEQNGICVVHDFAYGAVGFDGHKPLSFLQTEGAKETGIEIYTLSK
TYNMAGWRVGFAVGNASVIEAINLYQDHMFVSLFPAAQQAAAAALLADQACVAAQNDRYE
SRRNAWIEACRDIGWDVTAPAGSFFAWLPVPDGYTSQSFSDLLLEKADVAVAAGNGFGKW
GEGYIRVGLLTSEERLKEAAERIGKLNLFTRKSIDISG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaatctcagatgtactcaaacagctgccggaacaatttttcgcatcattg
gtgcaaaaagtgaatcaaaagctgaaagaaggcagagacgtcatcaatttagggcaggga
aaccctgatcagccgacgcctcagcatatcgttgaagaaatgaagcgcgccgtcgaaagg
ccggaaaatcataaatactcatcattccggggcgcttacagcttcaaaaaagcagccgct
gcattttatgaaagggagtacggggtcacgcttgatccggaaacggaagtcgccgtgctg
ttcggaggcaaggcgggacttgttgagcttccgcaatgtcttttaaaccctggagatacc
attctggtgcctgatcccggatatcctgattactggtcaggcgtcgcccttgcgaaagcg
aaaatggaaatgatgccgctgacggaggaaagagggtttctccctgattacagcgtaatt
cctgaaaaggtgcggagcgaggcgaagctgctgtatctcaattatccgaataatccgacc
ggcgctgtggcgacagaggcgtttttcgaggagacggtcggttttgcggagcaaaacggc
atttgtgtcgttcatgatttcgcgtacggagccgtcggctttgacgggcataaaccgctg
agctttttgcagaccgaaggcgcaaaagagacgggaatcgaaatctataccttgtctaaa
acctataatatggcgggctggcgggtcggatttgccgtcggaaacgcttctgtcatcgaa
gcgatcaacctttatcaggatcatatgtttgtcagtttgtttcccgcggcgcagcaggcg
gcggcagccgctcttttagcggatcaggcatgcgtcgcagcgcaaaatgacagatatgaa
tcgagacgcaatgcatggattgaagcctgccgcgatatcggctgggatgtgacggctccg
gcgggctccttttttgcatggctccctgtgcctgacggttatacgtcacagtcgttttca
gacctgctgctcgagaaagcggatgtcgcggtcgctgccggaaacgggttcggaaaatgg
ggggaaggctatataagagtcggtcttctgacaagtgaagaaagacttaaagaagctgcg
gaacggatcgggaaactgaatcttttcacccgaaaaagcattgacatatcaggataa

DBGET integrated database retrieval system