KEGG   Bacillus velezensis: NG74_01623Help
Entry
NG74_01623        CDS       T03423                                 

Gene name
prkC
Definition
(GenBank) Serine/threonine-protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bmp  Bacillus velezensis
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bmp01001]
    NG74_01623 (prkC)
Enzymes [BR:bmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     NG74_01623 (prkC)
Protein kinases [BR:bmp01001]
 Serine/threonine kinases: Other
  Bacterial family
   NG74_01623 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like Kdo APH RIO1 Haspin_kinase Pkinase_fungal Seadorna_VP7 PBP_N
Motif
Other DBs
NCBI-ProteinID: AIU81708
UniProt: A0A410L2D0
LinkDB All DBs
Position
1578571..1580514
Genome map
AA seq 647 aa AA seqDB search
MLTGKRISGRYHILRPIGGGGMANVFLAEDIILEREVAIKILRFDFVNDIDFIRRFRREA
QSASSLDHPNIVSIYDIGEEGDIYYIVMEYVEGMTLKEYITAHGPLHPKEALSVMEQIVS
AIAHAHQNHIVHRDIKPHNILIDHLGHIKVTDFGIATALTSTTITHTNSVLGSVHYLSPE
QARGGLATKKSDIYALGIVLFELLTGKIPFDGESAVSIALKHLQTETPSARKWNPSIPQS
VENIILKATAKDPFHRYESAEDMEADIRTAFDAGRLNEQKFSVQDDEEMTKAIPVITDGA
KAAPQAETPGETDDKEQQPAKKKKRKWPWVLLSVCFIFIMAAVLAVTVFPSLFMPKDVSV
PDVRGMKYEKAEALLEKNGLRADPDITDIEDDKIEEELMVKTDPKAGSTVKEGSSVKLYK
SIGKPKTQLIDVKGRQIGDAKKALKEKGFKHVNVKEENDDSEAGTVIDQDPSAGTDMVAS
DDEVNLTVSLGPADVTLRDLKTYSKEAASGYLEDNGLQLVEKQAHSDDVPKGQVMKQEPA
AGTAVKPGSNVEVTFSLGPEEKPAKTVKEKISIPYEPEHEGDELEVQIAIDDKDHSISDT
YDSFKIKEPTEKTIELKIDQGQKGYYQVMVDHKVVSYKTIEYPKDND
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaccggcaagcggatcagcgggcgttatcatatcctccggcccattggcggcggc
ggaatggcaaacgtttttttagctgaggacatcattctcgaacgtgaagtcgcaattaaa
attctgcggtttgactttgtgaatgacattgattttatcaggcgtttcagaagagaagca
cagtcggcatcaagcctcgatcatccgaatatcgtcagtatttacgatatcggggaggaa
ggcgatatttattacattgtcatggaatatgtggaaggcatgacattaaaggaatacata
accgcacacgggccgcttcatccgaaagaagcgctgtccgttatggagcagatcgtctcg
gccatcgcccatgcccatcaaaaccatatcgtgcaccgggatattaaaccgcacaatata
ttgatagatcatttagggcatatcaaggtgacggatttcggcatcgccacagcgcttacg
tctacgacaatcacacatacgaattctgtgctgggctcggttcattatttgtctccggag
caggcgagaggcggtctggcaacgaaaaaatcagatatttacgcactcggcatcgtgctg
tttgagcttttaacaggtaagatcccttttgacggagaatcagccgtaagcatagcgcta
aagcatctgcaaacagaaacgccttccgccagaaagtggaacccttccattccgcagagc
gtcgaaaacattattttaaaggcaaccgctaaagacccgtttcaccgctatgaaagcgcc
gaggacatggaagcggacatcagaacggcttttgacgccggcaggctgaatgaacaaaaa
ttttccgttcaggatgatgaggaaatgacaaaagccattcccgttattactgacggcgca
aaagccgcgcctcaggcggaaacgccgggggagacggatgataaggaacagcagcccgcc
aaaaagaaaaaacggaaatggccgtgggttttgctgtccgtttgtttcattttcattatg
gcggctgttcttgcggtcaccgtgttcccgtctttgtttatgcctaaagatgtaagcgtc
cccgacgtacggggcatgaagtacgaaaaagcggaagcactgcttgaaaagaacgggctc
cgggcggaccctgatataacggacattgaagatgacaaaatagaagaggaattaatggtc
aaaacggacccaaaagcggggtctaccgttaaagaaggctcttctgtaaaactgtacaaa
agcatcggaaaaccgaaaacccagctgatcgacgtgaaagggcggcagatcggcgacgca
aaaaaagcgctgaaggaaaaaggcttcaaacatgtcaatgtcaaagaagagaacgatgac
agcgaggccggcaccgtaattgatcaggacccgtcagccggcaccgacatggtcgcaagc
gacgatgaagtcaatctaacggtcagcctcggcccggcggacgtcacgctgagggactta
aagacttacagcaaagaagcggcttcagggtatcttgaagataacggcctgcagcttgtt
gaaaaacaagcccattcagatgacgtgccaaaaggacaagtcatgaagcaagagccggca
gccggcactgcggttaagccgggaagtaatgttgaagtgacgttctcgctcggacctgaa
gaaaaaccggcgaaaacggtaaaagaaaaaatcagcattccttacgaacccgaacatgaa
ggggacgagcttgaagtgcaaatcgccatcgatgataaggatcacagcatctctgatacg
tatgactcatttaaaataaaagagccgactgaaaaaacaattgaactgaagattgatcag
ggacagaaggggtattatcaagtgatggtcgatcataaagtcgtcagctacaaaacgatt
gaatacccgaaagataatgactga

DBGET integrated database retrieval system