KEGG   Bacillus velezensis: NG74_02610Help
Entry
NG74_02610        CDS       T03423                                 

Gene name
queA
Definition
(GenBank) S-adenosylmethionine:tRNA ribosyltransferase-isomerase
  KO
K07568  S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC:2.4.99.17]
Organism
bmp  Bacillus velezensis
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bmp03016]
    NG74_02610 (queA)
Enzymes [BR:bmp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.17  S-adenosylmethionine:tRNA ribosyltransferase-isomerase
     NG74_02610 (queA)
Transfer RNA biogenesis [BR:bmp03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    NG74_02610 (queA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Queuosine_synth Lar_N
Motif
Other DBs
NCBI-ProteinID: AIU82667
LinkDB All DBs
Position
complement(2652375..2653403)
Genome map
AA seq 342 aa AA seqDB search
MKVDLFDFELPERLIAQVPLKERDASRLMVLDKQTGGLTDSSFKEIVSFFNEGDCLVLNN
TRVLPARLFGTKEDTGAKVELLLLKQEENDTWETLVKPAKRVKKGTFLTFGDGRLTAVCT
EELDHGGRKIEFRYDGIFYEVLESLGEMPLPPYIKEQLDDKERYQTVFSKEIGSAAAPTA
GLHFTEEILDELKQKGVRIEFITLHVGLGTFRPVSADDVEEHNMHAEFYEMTEETAASLN
EVRKAGGRIVSVGTTSTRTLETIAGEHDGVFTASSGWTSIFIYPGYEFKAIDGMITNFHL
PKSSLIMLVSALAGREHVLSAYRHAVEEEYRFFSFGDAMLII
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgatttatttgattttgaactgcctgaacgcctcattgcccaagtgccgctt
aaagagcgtgacgcatcgcggcttatggtgctcgacaaacagacgggcgggctgacggac
agttcatttaaagagattgtaagcttttttaatgaaggggattgcctcgtcttgaacaat
acccgtgtgctgcctgcaagattattcggcacaaaagaagatacgggggcgaaagtggag
cttctgttattaaaacaggaagaaaatgatacatgggaaacgctcgtaaagccggcgaaa
cgcgtaaaaaaaggaacgttcctgacatttggcgacggccggctgacagcggtctgcacg
gaggagcttgatcacggaggcagaaaaatagaattccggtatgacgggattttttacgaa
gtgcttgaatcactcggtgaaatgccgctgcctccttatattaaagagcagcttgatgat
aaagaacggtatcagaccgtcttttcaaaagaaatcggatctgccgcagctccgacggcc
ggacttcattttacggaagagattctggacgagctgaagcaaaagggtgtgcggattgaa
tttatcacacttcatgtgggactcggcacattccgcccggtcagtgcggatgatgtggaa
gagcataacatgcacgcggaattttatgaaatgacggaagaaaccgccgcctctttaaac
gaggtcagaaaggcgggagggcgcatcgtgtcggtcgggacgacatcaacgcgcaccctg
gaaaccattgcaggcgagcatgacggcgtatttaccgcttcaagcggctggacgtccatc
ttcatttatccgggatatgaatttaaggcgattgacggcatgatcaccaattttcatctg
ccgaaatcttcgcttatcatgctcgtttctgcgcttgccggcagagagcatgttctttcc
gcctaccgtcatgcggtagaagaggaatatcgtttcttcagctttggcgacgccatgctg
attatctaa

DBGET integrated database retrieval system