KEGG   Bacillus velezensis: NG74_03144Help
Entry
NG74_03144        CDS       T03423                                 

Gene name
fadA
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
bmp  Bacillus velezensis
Pathway
bmp00071  Fatty acid degradation
bmp00280  Valine, leucine and isoleucine degradation
bmp00281  Geraniol degradation
bmp00362  Benzoate degradation
bmp00592  alpha-Linolenic acid metabolism
bmp01100  Metabolic pathways
bmp01110  Biosynthesis of secondary metabolites
bmp01120  Microbial metabolism in diverse environments
bmp01130  Biosynthesis of antibiotics
bmp01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NG74_03144 (fadA)
   00592 alpha-Linolenic acid metabolism
    NG74_03144 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NG74_03144 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    NG74_03144 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NG74_03144 (fadA)
   00642 Ethylbenzene degradation
    NG74_03144 (fadA)
Enzymes [BR:bmp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     NG74_03144 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIU83157
UniProt: A0A235BEA0
LinkDB All DBs
Position
complement(3153871..3155046)
Genome map
AA seq 391 aa AA seqDB search
MREAVIVAGARTPVGKAKKGSLAAVRPDDLGALCVKETLKRAGGYEGNIDDLIIGCATPE
AEQGLNMARNIGALAGLPHTVPAITVNRYCSSGLQSIAYGAEKIMIGAGDTVIAGGAESM
SQVPMMGHVTRPNIALAEHAPEYYMSMGHTAEQVAETYGVSREDQDAFAVRSHQNAAKAL
KEGKFNDEIVPVEVSLTEVGDDHKPRKKQFTFSQDEGVRPGTSADVLAKLRPAFSKTGTV
TAGNSSQTSDGAAAVMLMDREKASSLGLAPLVKFRSFAVGGVPPEVMGIGPIEAIPRALK
LAGLELQDIGLFELNEAFASQAIQVIRSLGIDEEKVNVNGGAIALGHPLGCTGTKLTLSL
IHEMKRRNEQFGVVTMCIGGGMGAAGVFELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagcagtcattgtggccggtgcgagaaccccggtcggtaaagcgaaaaaagga
tcgcttgcagccgttcgtcctgatgatttaggcgcgctttgtgtaaaagaaacgctgaaa
cgggcaggcggctatgaaggaaatatcgatgacttaattatcggatgcgcaacacctgaa
gccgaacaaggattaaatatggcgcggaatatcggtgcgctggcggggcttcctcatacg
gtgccggccattacggtgaaccgctactgctcttccgggctccaatccatcgcttacggt
gctgaaaaaatcatgatcggcgcgggtgacaccgtcattgcgggcggtgcggaatccatg
tcgcaagttccgatgatggggcatgtgacacggccgaatatcgctttggcggagcatgcg
cctgagtattacatgagcatggggcacacagcggagcaggtcgccgaaacgtacggcgta
tccagagaagaccaagatgcatttgccgtccgcagccatcagaatgccgcaaaagccctt
aaagaaggcaaattcaatgacgaaatcgtgccggttgaagtatcgctgacagaagtcggt
gatgaccataagccgcggaaaaaacaatttaccttttcacaagatgaaggcgttcgtccc
ggcacatcggctgacgtcttggcgaagctccgtccggctttttctaaaacgggaaccgtg
acggccgggaactcttcacaaacaagtgacggcgcggcggctgtcatgctgatggatcgc
gaaaaagcatcgtcgctcgggttggcgccgcttgtcaaattccgttcctttgccgtaggc
ggcgttccgcctgaggtaatggggatcggtccgattgaagccattccgcgggcgctcaag
cttgccggactcgaattacaggatatcgggctttttgaattgaatgaggcctttgcttca
caggccattcaagtcatcagatcgcttgggatagatgaagaaaaggtgaacgtcaacgga
ggcgccatcgcgctcggacatccgctcggatgcacgggaacgaagctgaccctgtcactc
attcatgaaatgaaacggagaaacgagcaattcggcgtggtgacgatgtgcatcggaggc
ggcatgggcgctgccggcgtatttgagctcatttaa

DBGET integrated database retrieval system