KEGG   Bacillus velezensis: NG74_03145Help
Entry
NG74_03145        CDS       T03423                                 

Gene name
fadN
Definition
(GenBank) putative 3-hydroxyacyl-CoA dehydrogenase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
bmp  Bacillus velezensis
Pathway
bmp00071  Fatty acid degradation
bmp00362  Benzoate degradation
bmp00650  Butanoate metabolism
bmp01100  Metabolic pathways
bmp01120  Microbial metabolism in diverse environments
bmp01200  Carbon metabolism
bmp01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NG74_03145 (fadN)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NG74_03145 (fadN)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NG74_03145 (fadN)
Enzymes [BR:bmp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     NG74_03145 (fadN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 ApbA
Motif
Other DBs
NCBI-ProteinID: AIU83158
LinkDB All DBs
Position
complement(3155057..3157426)
Genome map
AA seq 789 aa AA seqDB search
MHKFIKKAAVLGSGVMGSGIAAHLANIGIPVLLLDIVPNELTKDEMKKGLTLESPEVRSR
LSRSAMQKLLKQKPAPLTSAANLDYITAGNLEDDAAQLKDADWIIEVVVENLDVKKQIFS
LVDEYRKPGSIVSSNTSGISVTKMAEGRSADFKAHFLGTHFFNPARYLKLLEIIPIQETD
PDVLEFMTSFAENTLGKGVVIAKDTPNFIANRIGTYGLLVTVREMLSSGCRIGEVDTVTG
PLIGRPKSATFRTLDVVGLDTFAHVAKNVYDKADGAEKDMFKLPEFMNDMLKNNWLGSKS
GQGFYKKEGKTIYELDPLTMTYGERSKMKTPALEAAKQAKGAKGKMKALIYSDDRAGRLL
WNITSQTLLYSARLLGEIADDIKAIDDAMKWGFGWELGPFEMWDAIGVRKSAERLEEEGA
EIPGWVKDMLDQGHETFYMKENGTPFYYSDGQYRAVKENPKRISLQTLKETKGVITKNSG
ASLIDLGDDVALLEFHTKSNAIGLDIIQMIDNALEETDRNYKGLVIGNQGRHFCAGANLA
MILMEAQDDNFMEVDFVIRRFQQTMLNIKYSAKPVVAAPFGMTLGGGTEVCLPAARVQAA
SESYMGLVETGVGLIPGGGGNKELYMNYLNGGSELMDAAIKTFETIALAKVSGSAHEARD
MQILSAADRVSMNQDHLLHDAKQLAASLYDSGYRPPARKKVKVTGETGCAALLLGADQMR
RSGYLSDHDMKIAKKLAHVIAGGRVPFGTEVSEEYLLEIEREAFLSLAGEAKSQARMQHM
LVKGKPLRN
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagtttataaagaaagcagccgttctcggatcaggcgtcatggggtccggaatt
gccgcgcacttggctaacatcggaattcccgtcctgctgcttgatattgtgccaaacgag
ctgacaaaggatgagatgaaaaaagggctgacattagaaagcccggaggtccgcagcagg
ctgagccgatcggccatgcaaaagctgctgaagcaaaaaccggcgccgctgacttcggct
gccaatctcgactatataacggcggggaatttggaagatgacgcagctcaattaaaggat
gctgattggattattgaagtcgtcgtcgaaaatcttgacgtaaaaaaacagattttctca
ctcgttgatgaataccggaaaccgggaagcatcgtgtcgagcaatacgtccggtatctcc
gtcacaaaaatggcggaaggccgatctgccgattttaaagcccatttcttaggaacccat
ttctttaatccggcccgctacttaaagcttctggaaatcattccgattcaggaaacagat
cctgacgtgctggagtttatgacttcatttgcagaaaacacgctcgggaaaggtgtcgtc
atcgcgaaagacacgcctaactttatcgccaaccgcatcggtacgtacggcctgctggtc
acggtaagagaaatgctttcttccggctgccgcatcggcgaggtggacacggtgaccggg
cctttgatcggcagaccgaaaagcgcgaccttcagaacccttgacgttgtggggcttgat
actttcgcccatgtggcaaaaaatgtgtatgataaagccgacggcgctgaaaaagacatg
tttaagctgcctgaatttatgaatgacatgctgaaaaacaattggctgggcagcaaatca
ggccaaggtttttacaaaaaagaaggtaaaacaatatatgaactcgatccgctgaccatg
acatacggtgagcgctcgaaaatgaagacgcccgctttagaagccgccaaacaggcaaag
ggtgccaaaggcaaaatgaaagcgcttatatactccgatgaccgcgccggacgcctgctt
tggaatattacatcgcaaacactcttatactcagcccggcttttaggtgagatcgctgat
gatatcaaagcgattgacgacgccatgaaatggggcttcggatgggagctcggcccgttt
gagatgtgggatgccatcggcgtcagaaaatcagcggagcggctcgaagaagaaggcgca
gaaatccccggctgggtgaaagatatgcttgatcagggccatgaaacattttatatgaag
gaaaacggaacaccattttactattcagacggccaatacagggctgtgaaagaaaatccg
aaacggatcagcctgcaaacgttaaaagaaacaaaaggcgttatcactaaaaacagcggc
gcaagtctgattgatctcggcgatgatgtcgcgctgctggaatttcatacgaaaagcaac
gcgatcggcttagacattattcagatgattgacaatgcgcttgaggaaaccgatcggaat
tataaaggacttgtcatcggaaaccaaggcagacatttctgcgcgggggcaaaccttgcg
atgattttgatggaagctcaggatgataacttcatggaagtcgattttgtcatccgccgt
tttcagcagacgatgctgaacatcaaatacagcgctaaacccgttgtcgcggcgccattc
gggatgacactcggcggcggcacggaagtctgtctcccggcggcacgcgttcaggcggcg
agcgaatcgtatatgggtcttgttgaaaccggcgtcggccttattccgggcggcggagga
aacaaagagctgtacatgaattatttgaacggcggaagtgaactgatggacgcggccatt
aaaaccttcgaaacaatcgcgcttgccaaagtgtccggttcggcacacgaagcccgtgat
atgcagattttgtccgcggcagaccgtgtcagcatgaatcaggatcacctgctgcacgat
gcgaaacagctggctgcttccttatatgacagcggataccgcccgcctgcccgcaaaaaa
gtgaaagtcaccggagaaaccggctgtgcggcattactgctcggagcagaccaaatgaga
cggtcgggttatttatccgatcacgatatgaagattgcgaagaagctggcccatgtcatt
gccggcggaagagtcccgttcggcacggaggtttcagaagaatatttactcgagattgaa
agagaagcctttttaagcctcgctggcgaggcgaaatctcaagcgagaatgcagcatatg
ctcgtcaaaggcaaacctttacggaactag

DBGET integrated database retrieval system