KEGG   Bacillus velezensis: NG74_03156Help
Entry
NG74_03156        CDS       T03423                                 

Definition
(GenBank) hypothetical protein
Organism
bmp  Bacillus velezensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YusW Acid_PPase
Motif
Other DBs
NCBI-ProteinID: AIU83169
UniProt: A0A1D9PNN4
LinkDB All DBs
Position
complement(3165961..3166398)
Genome map
AA seq 145 aa AA seqDB search
MKWFRTAGVLCLTLMLIAGCRLNEEKREAEQDSTPVSSAKPVPYSSFSLRVSYGAGEHNR
YEGLYERKSGHEKADIRDKLSGVHREGEEALDEMKMILGELAVNSRMQESEVVRQVLSAF
NLDSRYDHFYLKLKKNDGEMTEIKK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggttcaggacggcgggcgttttatgtcttacgctgatgctgattgccggctgc
cgattgaatgaagaaaaacgggaagcggaacaagacagcacacccgtgtcatccgcgaag
ccggttccttacagcagcttttcccttcgcgtcagctacggagccggagagcataaccgc
tatgaaggtttgtatgaaagaaaaagcggtcatgaaaaggcggacatccgggacaagctc
tcaggggttcacagagagggcgaggaagcgcttgatgaaatgaagatgatcctcggagaa
cttgccgtaaacagccggatgcaggaaagcgaggtcgtccggcaggtgctctcggctttt
aatttagacagccgctatgaccatttttatctgaaactgaaaaagaacgacggagaaatg
acagaaataaaaaaataa

DBGET integrated database retrieval system