KEGG   Bacillus velezensis: NG74_03381Help
Entry
NG74_03381        CDS       T03423                                 

Gene name
hisZ
Definition
(GenBank) ATP phosphoribosyltransferase regulatory subunit
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
bmp  Bacillus velezensis
Pathway
bmp00340  Histidine metabolism
bmp01100  Metabolic pathways
bmp01110  Biosynthesis of secondary metabolites
bmp01230  Biosynthesis of amino acids
Module
bmp_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    NG74_03381 (hisZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: AIU83388
LinkDB All DBs
Position
complement(3378739..3379911)
Genome map
AA seq 390 aa AA seqDB search
MFMFEKPHGMRDTLPGLYEAKKKVRSTLTDLIDKWGYQFMETPTLEFYETVGVQSAIEEQ
QLFKLLDQDGKTLVLRPDMTGPIARVAASKLHKHNHPLRAGYAASVYRAQEREGGRPAEF
EQVGAELIGDGSTSADAEVIALAAGALKNAGLHRFKIAIGHAGLADELFVEVLGNAERAD
VLRRFLFEKNYVGYREHVKSLPLSSIDKSRLLALLELRGGKEICAKAEEIIGISGQSLIQ
ELEDLWDILEDYGCAEHIRLDLNMVSHMSYYTGILFEVYAANVGFVIGSGGRYNNLLGHF
GSPAPATGFGLRIDRLIEALGIQEETSEADAVIFSKEQRAQAILFAEEERARGRKVVLQD
LAGIENIDHMTKSFVNVTYFIGARKEEQNG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtttatgtttgagaaaccgcatggcatgagagatacgctgcccggtttatacgaagcc
aagaaaaaagtccgttccacactgacggatttaattgataaatggggttatcagtttatg
gagacgccgacccttgaattttatgaaacagtaggcgtccagtcagctattgaagaacag
cagctatttaagcttctcgatcaggacggaaaaacgcttgtgcttcggcctgacatgacc
ggaccgattgccagggtggcggcgtctaagctgcacaaacacaatcatccgctcagagcg
gggtacgcggcaagcgtctatcgcgctcaggagcgggaaggcggacgtccggcagaattt
gaacaggtcggcgcggagctgatcggcgacggatcaacaagcgcggacgccgaggtgatt
gcgctggcggccggcgctttgaaaaacgcgggattgcaccggtttaaaatcgcgatcggc
catgccggactcgctgatgagctgtttgtcgaggttttgggcaatgccgagcgggcggat
gttctgcggcgctttctctttgaaaagaattacgtgggatacagggaacatgtcaaatcg
cttccgctttcttcaatagacaaaagccggctgctcgcacttctggaattgcgaggcggg
aaagaaatctgcgccaaggcggaggagatcatcggcatctccggacaaagcttgattcag
gagctggaagacctgtgggacattcttgaggattacgggtgtgccgagcatattcgcctt
gatctgaatatggtcagccatatgagttattacacgggaattttattcgaagtgtacgcg
gcaaatgttggtttcgtcatcggaagcggcggacgctataacaatcttctcggccatttc
ggcagtcccgctcccgccacgggtttcgggctccgtatcgacaggctgattgaagcgctc
ggcatccaggaagaaactagtgaagcggacgctgtgattttcagcaaggagcagcgggcg
caggccattttattcgcggaggaagaaagggcgagaggcagaaaagtcgtcctgcaggat
ttagcgggcattgaaaatatcgatcatatgacaaaatcattcgtaaacgtcacatacttt
atcggtgcaagaaaggaagagcagaatgggtaa

DBGET integrated database retrieval system