KEGG   Bacillus velezensis: NG74_03445Help
Entry
NG74_03445        CDS       T03423                                 

Gene name
tuaH
Definition
(GenBank) Putative teichuronic acid biosynthesis glycosyltransferase TuaH
  KO
K16699  teichuronic acid biosynthesis glycosyltransferase TuaH [EC:2.4.-.-]
Organism
bmp  Bacillus velezensis
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bmp01003]
    NG74_03445 (tuaH)
Enzymes [BR:bmp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     NG74_03445 (tuaH)
Glycosyltransferases [BR:bmp01003]
 Others
  Other glycosyltransferases
   NG74_03445 (tuaH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_trans_1_4 Glycos_transf_1 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: AIU83452
LinkDB All DBs
Position
complement(3468514..3469710)
Genome map
AA seq 398 aa AA seqDB search
MKVEPIIHVIVGAAEWGHDRLRYRRHRLAEFLARQKETKSVIWVCPSPRANDGQMAGIAE
GIRQFTVKDLMQKKAFRFGRYTDMCYRHKLSPLLNMLKEEGEGARCCLWYTFPGFPLLAD
LFPWDEVIYDCSDLWAAPISGRSGVLSNVRRNIIRQAEMRIIQRADSITCTSDCLHREVG
KKLENPYQKVFTIENGVEYDLFSRENKQPDEDILRGRNGTVLGFIGGIKPKLDFALMAET
ADVRPDWTILLVGPNTAQDDPDFESLLDRPNVIWTGPAAPNEVPSYMQLVDIGIMPYKNS
PYNDAVFPLKLFEFLAAGKPVVGCNLSSTSKIKRPFVYEYVEGSDPADFIAACDALLAAD
RSGSYEALRRELARKRDWNVLFGRMLECTGILKNAQSH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtggaaccgattattcacgtaatcgtcggagcggcggaatgggggcatgaccgg
ctgagatacagacggcaccggctggctgaatttctcgcccggcaaaaagaaacgaaaagc
gtcatttgggtatgcccgtctccgcgagccaatgatggtcagatggccgggatcgccgag
ggaatccggcagttcactgtaaaggatctcatgcagaaaaaagctttccgcttcggcagg
tatacagacatgtgctacaggcataagctttcaccattgttgaacatgctgaaggaagaa
ggagaaggggcccgctgctgcttatggtacaccttccccggttttccgctgctggcagat
ctgtttccttgggatgaagtgatttacgattgcagtgatctgtgggccgctccgatcagc
ggccggtccggggtgctgtcaaatgttagaagaaacatcattagacaggcggaaatgaga
atcattcagcgtgccgattccataacatgtacatctgactgtctgcaccgggaggtcgga
aaaaagctggagaatccgtaccaaaaagtgttcaccattgaaaacggagtggaatatgac
ctgttttcacgggaaaataaacagccggatgaagacattttacggggacggaacggaacg
gttctcggttttatcggcggaatcaaaccgaagctcgattttgcgcttatggcggaaacg
gcagatgtgaggcctgattggacgattttattggtaggcccgaacacggctcaggacgat
ccggatttcgagtcgcttttggaccgtccgaatgtcatctggacgggacctgccgcgccg
aatgaagtgccgtcctatatgcagcttgtcgacatcggcatcatgccgtataaaaattca
ccttataatgacgcggtatttccgcttaagctttttgaatttttagccgccgggaaaccg
gttgtcggctgcaacctttcttctacgtcaaaaatcaaaaggcctttcgtctatgaatac
gttgaaggcagtgaccccgcagatttcatcgcggcctgcgacgcgcttctggcagcggac
cgcagcggatcatatgaggctttgcgccgtgaattggcccggaaacgggattggaatgtt
ttattcggccgaatgctcgaatgcacgggtatattgaaaaatgcgcaatcccattaa

DBGET integrated database retrieval system