KEGG   Bacillus velezensis: NG74_03497Help
Entry
NG74_03497        CDS       T03423                                 

Definition
(GenBank) hypothetical protein
  KO
K06325  spore coat protein B
Organism
bmp  Bacillus velezensis
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    NG74_03497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2642
Motif
Other DBs
NCBI-ProteinID: AIU83504
UniProt: A0A410L7N8
LinkDB All DBs
Position
complement(3529769..3530662)
Genome map
AA seq 297 aa AA seqDB search
MKRNTKRQRSDDNFLHAMEGKVITVYRGGPESKTGRLADIQSDYIALQVDNKIVYYQWKH
VKSVTENTSETVSPAEAAECEKADDFQDLISRMTNRTVQLNQGGPESKRGKLHETGDDFL
VLETEDDGIVYFNADHVKSISAEQEEDGQEEERPEFEMADDFHGIFKRLIHKWVSINRGG
PEAVEGILVDNSDGHYTLVKDKEVLRIYPFHIKSISEGAKGAAKKEENKDDENKGEKESA
EEEKPHEEESREEKRTSSKKSKRSSRSVRSSKREKEVSYSYATVLRTIDYRWKRGRK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaatacgaagcggcagcggtctgatgacaactttttgcatgcgatggaagga
aaagtaattactgtctaccggggaggcccggagtccaagacagggagattagcagacatt
caatcggattatatcgctcttcaggttgataataaaatcgtttattatcaatggaaacac
gtgaaaagtgtgacggaaaatacgagtgaaaccgtatcgccggccgaagcggcagaatgt
gaaaaagctgatgattttcaagacctgatcagccggatgaccaatcgcacggtgcaattg
aatcagggaggtccggaatcgaaaagaggaaagcttcacgaaacaggggatgattttctc
gtgctggaaacggaagatgacggaattgtatattttaacgccgaccatgtcaaaagcatc
agtgcagaacaagaagaggacggccaagaggaggagcgcccggaatttgaaatggctgat
gattttcacggcatatttaaacgcctgatccacaaatgggtatccatcaaccgcggaggt
cctgaagccgttgaaggtatacttgtggataattccgacggccactacactcttgtgaaa
gataaagaagtgctgcggatctatccttttcatatcaagagcatcagcgaaggggcaaaa
ggagcagctaaaaaagaggagaataaagacgacgagaataaaggtgagaaagagagcgcc
gaagaagaaaagccgcatgaagaagaatcacgcgaagagaagcgtacttcctctaaaaag
tcgaaaagatcatcaagatccgttcgatcctcaaaacgggagaaagaggtctcttatagc
tacgccactgtattaaggacaatagattaccggtggaaacgcggccgtaaatga

DBGET integrated database retrieval system