KEGG   Bacillus megaterium QM B1551: BMQ_0093Help
Entry
BMQ_0093          CDS       T01208                                 

Gene name
hslO
Definition
(GenBank) chaperonin HslO
  KO
K04083  molecular chaperone Hsp33
Organism
bmq  Bacillus megaterium QM B1551
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bmq03110]
    BMQ_0093 (hslO)
Chaperones and folding catalysts [BR:bmq03110]
 Heat shock proteins
  HSP33
   BMQ_0093 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 DUF3222 Peptidase_M3_N SurA_N_2 Elf1
Motif
Other DBs
NCBI-ProteinID: ADE67209
UniProt: D5DVP4
LinkDB All DBs
Position
82157..83035
Genome map
AA seq 292 aa AA seqDB search
MGDYLVKALAYNSQVRAYAVKTTDTVGEAQRRHYTWPTASAALGRSMTAGVMMGAMLKGE
QKLTIKIEGRGPIGVILVDSNAKGEVRGYVTNPQTHFDLNQHGKLDVARAVGTDGTLSVV
KDIGMRDQFNGQVPIVSGELGEDFTYYFVTSEQVPSSVGVGVLVNPDNTILAAGGFIIQL
LPGTDDKTITAIEQRLQTIEPISKLIQKGLSPEEILEEVLGKENVKFLETMPVEFKCQCS
EERIANAIISLGQEEIQSMIEEDGQAEAQCHFCNETYRFDKKQLEEMKEQAI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgggtgactatttagtaaaagcactagcttacaatagtcaagttcgcgcttatgcagta
aaaacaacggatacagttggagaagcgcagcgccgtcactatacatggcctacagcctct
gcagcattgggacgttcaatgactgcgggagtcatgatgggggctatgctaaagggtgag
caaaagctaacaattaaaattgaaggtcgcggcccaattggcgttattttagtagacagc
aatgctaaaggggaagtgcgcggatatgtaacgaatccacaaacgcacttcgatttaaat
cagcatggaaaattagatgtagcacgtgctgtaggtacagatggcacgctaagtgtcgta
aaagatatcggaatgcgtgatcaatttaacggacaagtacctattgtatcgggagaatta
ggagaggatttcacgtattattttgtgacatctgaacaagtcccatcttcagtaggtgta
ggtgtacttgttaaccctgataacacgatcttagctgcgggcggatttatcattcagctt
ctgccaggaacagatgataaaacgattacagctattgaacaacgcttacagacgattgaa
ccaatttcaaaactgattcaaaaaggtctttctcctgaagaaatcttagaagaagttctt
ggaaaagaaaatgtaaagtttctggagacaatgcctgtagagttcaaatgtcagtgctca
gaagaaagaattgccaatgctattatcagcttaggacaagaagagattcaatcgatgatt
gaggaagacggccaagctgaagcccagtgtcatttctgtaatgagacctatcgttttgat
aaaaagcagcttgaagaaatgaaagaacaagcaatttaa

DBGET integrated database retrieval system