KEGG   Bacillus megaterium QM B1551: BMQ_0219Help
Entry
BMQ_0219          CDS       T01208                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00473  D-Alanine metabolism
bmq00550  Peptidoglycan biosynthesis
bmq01100  Metabolic pathways
bmq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BMQ_0219 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BMQ_0219 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BMQ_0219 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmq01011]
    BMQ_0219 (ddl)
Enzymes [BR:bmq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BMQ_0219 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bmq01011]
 Precursor biosynthesis
  Amino acid ligase
   BMQ_0219 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_ST ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADE67320
UniProt: D5DWS5
LinkDB All DBs
Position
192661..193743
Genome map
AA seq 360 aa AA seqDB search
MKIKLGLLYGGKSAEHKVSLQTALAVSKAINHDKYEVHPIYITETGKWIRGTQLTGPLET
VAQLEIQDNGTAISPVSLNTEMFALTDSKTDDQLDVIFPLLHGPNGEDGTVQGLLELLNI
PYVGNGVLASAAGMDKVVMKQLFAQAGLPQVEYVSFIRREWEADRTAAYEKVETLGYPCF
VKPANLGSSVGISKCDNREELEAAFVEAFLFDRKIIVEAAAVGREVEIGVLGNDEAACSV
VGEILPKKAFYDYKAKYEDGDTGLIIPAEITEEQHQEMSALAIKAFKAIDGSGLVRADFF
LTSEGKFIINEVNTMPGFTPFSMFPLLWKHAGVEYPDLIEKLVSLAIERHTEKQQIKHTM
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattaagcttggccttttatacggaggaaaatccgctgaacataaagtatcttta
caaacagctctagcagtttcaaaagcaattaaccacgataaatatgaagtgcatccaatt
tacattacagaaacaggaaagtggattcgcggcacacagctgactggtccgcttgaaaca
gttgctcaattagaaattcaagataacggaactgctatttcaccagtttcattgaatacg
gaaatgtttgcattaacagattcaaaaacagatgatcagctagatgttattttcccactt
cttcatggtccaaatggagaagatggtacggtacaaggattattagaattattgaatatt
ccttatgttggaaacggtgtattagcttcagcagctggtatggataaagttgtaatgaag
cagctgtttgcacaggcaggtctgcctcaagtagagtacgtatcatttatccgccgcgag
tgggaagcagatcgaacggctgcttatgaaaaagtagaaacacttggatacccttgcttt
gttaaaccagcaaacttaggttcaagcgttgggattagcaaatgtgataaccgcgaagag
ttagaagcggcatttgttgaagctttcttattcgatcggaaaatcattgtagaagcagca
gcagttggtcgtgaagttgaaattggtgtgttagggaatgatgaagcagcttgttcagta
gttggagaaatcttacctaaaaaagcgttttacgattacaaagccaaatatgaagacggc
gatacaggtcttattattccagctgaaattacagaagaacagcatcaagaaatgtcagca
ctagcaatcaaagcatttaaagcaatcgatggatctggtcttgtacgtgcagatttcttc
ttaacatcagaaggtaaattcattattaatgaagtgaatacgatgcctggttttacacct
ttcagtatgttcccgttattgtggaaacacgcaggtgttgaatatccagatttaattgaa
aaacttgtatcactagcaattgaacgtcataccgaaaagcagcaaattaaacacacaatg
taa

DBGET integrated database retrieval system