KEGG   Bacillus megaterium QM B1551: BMQ_0226Help
Entry
BMQ_0226          CDS       T01208                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00473  D-Alanine metabolism
bmq01100  Metabolic pathways
bmq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BMQ_0226 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BMQ_0226 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmq01011]
    BMQ_0226 (alr)
Enzymes [BR:bmq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BMQ_0226 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bmq01011]
 Precursor biosynthesis
  Racemase
   BMQ_0226 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C MCR_alpha_N
Motif
Other DBs
NCBI-ProteinID: ADE67327
UniProt: D5DWT2
LinkDB All DBs
Position
200268..201458
Genome map
AA seq 396 aa AA seqDB search
MVLKKGSVVVMDAFYRETWAEIDVEAIFQNVNHVRELIPGHKTLMAVVKANAYGHGDKEV
AEIALQAGADMLAVAFLDEAIALRKKGIKESILVLGAVPTLHIQTALEWDVTVTAYSKAW
IEEAASILDENSQLHMHLKIDTGMGRLGVRTKEELHETMKIIASHSGFVLDGVFTHFATA
DELNSSYFEEQYTFFEEMVRIVKEYNFTPPMIHCANSAALLRRPKDIFNGVRLGISMYGL
SPSEELKEVLPIPLKQAFSLHSRIVHVKKVKKGSHISYGATYEAKEDEWIATIPVGYADG
WIRKLSNFEVLVDGVKVPIVGRICMDQLMIKLPKMYKMGTKVTFIGKQKGAEITIDEVAK
HLETINYEIPCMVAARVPRVYTRDSQHIDVNNYILR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggttctgaaaaaaggaagtgtcgtagtaatggatgcattttatagagaaacatgggca
gaaattgatgtagaagccatttttcaaaatgtgaatcatgtaagagaactgataccgggg
cataaaacgttaatggccgtagtgaaggcgaatgcgtacgggcatggagataaagaagta
gcagagattgcgcttcaagctggtgctgatatgctagctgtagcttttttggatgaagct
attgctcttcggaaaaaagggataaaggaatccattttagtattaggcgccgtgcctacc
ctacacattcaaactgcattggagtgggatgtaacggtcactgcttatagcaaagcttgg
attgaagaagcggcgtccattctagatgaaaacagtcagctgcatatgcatttaaaaata
gatacaggcatgggtcgcttgggagttagaacaaaagaagaattacacgaaacgatgaag
atcatcgcttctcattcgggattcgtgctggatggagtgtttacacactttgcaacagca
gacgagctaaactcgtcttattttgaagaacaatacacattctttgaagaaatggttcga
attgtgaaagagtataattttacacctccgatgattcactgtgcaaatagcgcagccttg
cttcgtcgtccgaaagatatctttaatggcgtacgcttaggtatctctatgtatggcttg
agtccttctgaggaattaaaagaagtcttgccaattccgttaaaacaagctttttcgctg
cacagccgtattgtgcatgttaaaaaagtcaaaaaagggagtcatatcagttacggagct
acttatgaagctaaagaagatgaatggattgctactattccagtaggatatgcagacggc
tggattcgtaaattaagcaattttgaagtattagtagatggagtcaaagtgccaattgtt
ggtagaatctgcatggatcaattgatgattaaattacctaaaatgtataaaatgggtaca
aaagtaacgtttattggaaaacaaaaaggtgctgaaattacaattgatgaagtagcgaag
catcttgaaacaattaattatgaaatcccttgcatggttgcagcaagggttccgagggtt
tatacaagagattcgcagcatattgatgttaataattatatcttgcgctga

DBGET integrated database retrieval system