KEGG   Bacillus megaterium QM B1551: BMQ_0532Help
Entry
BMQ_0532          CDS       T01208                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00564  Glycerophospholipid metabolism
bmq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BMQ_0532 (glpD)
Enzymes [BR:bmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BMQ_0532 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 GMC_oxred_N GIDA FAD_oxidored Pyr_redox_2 Pyr_redox DUF3606 NAD_binding_8 Cation_ATPase_N
Motif
Other DBs
NCBI-ProteinID: ADE67589
UniProt: D5DYU7
LinkDB All DBs
Position
498898..500577
Genome map
AA seq 559 aa AA seqDB search
MFSSQTRSNKLVDMTQNQYDLLVIGGGITGSGIALDATHRGMKTALVEMQDFAAGTSSRS
TKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHTGGTFGKFSTSIG
LRVYDFLAGVKRSERRKMFSAEETLSREPLVKSKDLKGGGYYVEYKTDDARLTIEVAKEA
AARGADLVNYTKVENFIYDKGKVVGVVVRDQLTNKEYNIYAKKIVNAAGPWVDTLREKDN
SKKGKQLQLTKGIHLVIDQERFPLKQAIYFDTPDGRMVFAIPRDGKTYVGTTDTVYKEDA
RHPRMTVKDRQYVIDAINYMFPTVDITVDDVESSWAGVRPLIHEQGKDPSEISRKDEIWT
SESGLITIAGGKLTGYRKMAEIVVNRVAEDFKAEGREFESCQTKHLPISGGNVGGSGGFP
TFVEQKVKEGIKLGLSRDAAEKLVKRYGSNVDKVYRYMIERPDQLKNSDLPASVFLQIQY
GIEEEMVSKPVDFFIRRTGALFFDINWVRSWKKQVIAHMAEELKWTPEQTKAYTDELEQH
LHDAVVPVDEKVNRMTGIS
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaagtcaaacacgttcgaataaattggtagacatgacacaaaatcaatatgat
ttactagtaattggtgggggaattactgggtcaggtattgcgcttgatgcgactcatcga
ggcatgaaaacggcattagttgaaatgcaggatttcgcagcaggaacatctagtcgttca
acgaagcttgttcacggcggtctacgctatttaaaacagtttgaagttaaaatggtagcc
gaagttggtaaagaacgtgccatcgtatatgaaaatgggcctcatgtaacgactccggag
tggatgctgttacctttccatacgggtggaacattcggtaaattctcaacttcaattgga
ctgcgcgtatatgattttttagctggtgtaaaacgctcagagcgccgcaaaatgtttagc
gcagaagaaacgcttagccgcgagccattggtgaaatctaaagatttaaaaggcggcggt
tactacgttgaatataaaacagatgatgcacgtttaacgattgaagtagctaaagaagct
gccgcaagaggagcagacttagtcaattacacaaaagtggaaaacttcatctacgataaa
ggaaaagtagtaggggttgttgttcgtgatcagcttacgaataaagaatataatatttat
gcaaaaaaaatcgtcaacgctgcaggtccatgggtggacacgctgcgtgaaaaagataat
tcaaaaaaaggcaagcagcttcaattaacaaaaggaattcacttagttattgatcaagag
cgctttccattaaaacaagccatttattttgatacacctgatggacgtatggtgtttgca
attccgcgtgatggaaaaacatatgtgggcacaacagacacggtctataaagaagacgct
agacatccgcgtatgactgtaaaagaccgtcaatatgttattgatgcgattaactatatg
ttcccaacggttgatattacagtagacgacgtagaatcaagctgggcgggtgttcgtcca
cttattcacgaacaaggaaaagatccttctgaaatctcgcgtaaagatgaaatctggaca
tcagaatcaggtttaattacaatcgctggagggaaattaactgggtaccgtaaaatggct
gaaattgtcgtaaatcgcgtagctgaagattttaaagcagaaggacgcgaatttgaaagc
tgtcaaactaaacatttacctatttctggaggtaatgtaggcggttcaggtgggttccca
acgtttgtagagcaaaaagtcaaagaaggcatcaaactagggttatcacgtgacgctgct
gaaaagcttgtaaaacgctatggttcaaacgtagataaagtataccgctacatgattgaa
cgtcccgatcagctaaaaaacagcgaccttccagctagtgtatttctgcaaattcaatat
ggcatagaagaagaaatggtttcaaaaccagtggacttcttcattagacgtacgggcgct
ttattctttgatatcaactgggtaagaagctggaaaaaacaagtgattgctcatatggcc
gaagagttaaagtggacgcctgagcaaacaaaagcttatacggatgaattagaacagcac
cttcatgacgcagttgtaccagtagatgaaaaagttaaccgtatgacaggtatttcatga

DBGET integrated database retrieval system