KEGG   Bacillus megaterium QM B1551: BMQ_0544Help
Entry
BMQ_0544          CDS       T01208                                 

Gene name
tcyA
Definition
(GenBank) L-cystine import ABC transporter, L-cystine-binding protein TcyA
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BMQ_0544 (tcyA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmq02000]
    BMQ_0544 (tcyA)
   02035 Bacterial motility proteins [BR:bmq02035]
    BMQ_0544 (tcyA)
Transporters [BR:bmq02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    BMQ_0544 (tcyA)
Bacterial motility proteins [BR:bmq02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    BMQ_0544 (tcyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd NMT1 DUF4969 ETRAMP
Motif
Other DBs
NCBI-ProteinID: ADE67601
UniProt: D5DYV9
LinkDB All DBs
Position
complement(509948..510769)
Genome map
AA seq 273 aa AA seqDB search
MKKFAALLSLLLAFTVVLAACGSSSKNEANNGDNKSSQGDLYNKVKKDGVLTIGTEGTYP
PFTFHDDKQKLTGFDVELAQEVAKRLGVKAEFKETQWDGMFAGLDAKRFDMIANEVGIRE
DRQKKYDFSDPYIQSGAVLIVRKDEKDIKSFKDLKGKKSAQSLTSNYKDMAQSYGANITS
AEGFAQAVELMSANRVDATINDKLSFLDYKKKHPNAPIKIADEKSDGAASGFMFRKDSGK
LVDEVNKALKDMKKDGTYAKISKKWFGEDVSPK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatttgctgcacttttgtcgctactattagctttcacagttgtgcttgccgca
tgcggttctagctcaaaaaatgaagcaaacaatggagacaataaatcttcacaaggggat
ttatataataaagtgaaaaaagatggtgtattaacaattggaactgaaggtacataccct
ccgttcacttttcatgatgacaaacaaaagctaactgggtttgatgtagaattggctcaa
gaagtagctaaacgtcttggcgtaaaagctgagttcaaagaaacacagtgggatggcatg
tttgccggattagatgctaaacgctttgacatgattgctaatgaagtgggtattcgtgaa
gatcgtcaaaagaaatacgatttctctgacccatacatccagtcaggcgctgtattaatt
gttcgtaaagacgaaaaagatatcaaatcatttaaagatttaaaaggaaaaaaatcagcg
cagtcattaacaagtaactataaagacatggctcaatcttatggtgcaaacattacgagt
gctgaaggttttgctcaagcagtagaactaatgagcgcaaaccgtgttgatgctacaatc
aacgataaattatcgttccttgactataagaaaaagcaccctaacgcacctatcaaaatc
gcggatgaaaaatccgatggtgctgcaagcggctttatgtttagaaaagacagcggtaag
ttagtggatgaagtaaacaaagcattgaaagatatgaaaaaagacggaacatacgcaaaa
atttctaagaaatggtttggcgaagatgtttctcctaaataa

DBGET integrated database retrieval system