KEGG   Bacillus megaterium QM B1551: BMQ_1538Help
Entry
BMQ_1538          CDS       T01208                                 

Gene name
hxlA
Definition
(GenBank) 3-hexulose-6-phosphate synthase
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00030  Pentose phosphate pathway
bmq00680  Methane metabolism
bmq01100  Metabolic pathways
bmq01120  Microbial metabolism in diverse environments
bmq01200  Carbon metabolism
bmq01230  Biosynthesis of amino acids
Module
bmq_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
bmq_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMQ_1538 (hxlA)
  09102 Energy metabolism
   00680 Methane metabolism
    BMQ_1538 (hxlA)
Enzymes [BR:bmq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     BMQ_1538 (hxlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase TMP-TENI Ribul_P_3_epim QRPTase_C PEP_mutase 4HFCP_synth IGPS
Motif
Other DBs
NCBI-ProteinID: ADE68570
UniProt: D5E1M0
LinkDB All DBs
Position
1512890..1513531
Genome map
AA seq 213 aa AA seqDB search
MELQLALDLVNISEAKEVVQEVQEYIDIVEIGTPVVINEGLKAVKEIKEAFPSLKVLADL
KIMDAGAYEVMKASEAGASIITILGATDDSTIKGAVEEAKKQGTQILVDMINVKNLEQRA
KEVDALGVDYICVHTGYDLQAEGETPFEQLQTIKRVVKNAKTAVAGGIKLNTLPEVVQSQ
PDLVIVGGGITSEKDKRNVAEEMKKVVKQATLV
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggaacttcaattagcattggatcttgtaaatatttcagaggcaaaagaagtagtgcag
gaggttcaagagtatatcgatattgtagaaattggaactccagttgtgattaacgaaggg
ctaaaagcagtcaaagaaatcaaggaagcctttccgtctttaaaggtattagctgatttg
aaaattatggatgcaggtgcttatgaagtaatgaaagcttctgaagcgggtgctagtatt
attaccattcttggcgctactgatgattcgactataaaaggcgctgtagaagaggccaaa
aaacaaggaacacaaattcttgttgatatgattaatgtaaaaaaccttgaacaacgtgca
aaagaagtcgatgcactcggtgttgactatatttgtgtacacacagggtatgatcttcaa
gctgaaggagaaaccccgttcgagcagcttcaaacgattaaacgagttgtgaaaaatgca
aaaacagcggtggcaggaggcattaaactgaatacacttcctgaagttgtgcagtcacag
cctgatcttgtgattgtaggcggggggattacaagtgaaaaagacaaaagaaacgttgca
gaagaaatgaaaaaagtagtcaaacaagcaactttggtctaa

DBGET integrated database retrieval system