KEGG   Bacillus megaterium QM B1551: BMQ_1588
Entry
BMQ_1588          CDS       T01208                                 

Gene name
levD
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IIA component
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00051  Fructose and mannose metabolism
bmq02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BMQ_1588 (levD)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BMQ_1588 (levD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmq02000]
    BMQ_1588 (levD)
Enzymes [BR:bmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BMQ_1588 (levD)
Transporters [BR:bmq02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BMQ_1588 (levD)
SSDB
Motif
Pfam: EIIA-man DUF4460
Other DBs
NCBI-ProteinID: ADE68620
UniProt: D5E2J3
LinkDB
Position
1570486..1570863
AA seq 125 aa
MIFGEENHVVAVPFLKGEGIQTLEEKYKQALEEMPLENEVLFLVDIFGGTPYNAATPYIL
KNKTADMVSGVNLPMLLEVLAMREHVTLKEMLGRLKQVNEESFQVCSEHLEKIQQANQIG
EDGLL
NT seq 378 nt   +upstreamnt  +downstreamnt
atgatatttggtgaagagaatcacgtagtagccgtaccttttctaaaaggagagggtatc
caaacccttgaagaaaaatataaacaggcactagaggaaatgcccttagaaaatgaagtg
ctttttttagtcgatattttcggaggtacaccctacaatgcggctactccatatatcctt
aaaaataaaacagcggatatggtatccggagttaacttgcctatgctattagaagtgtta
gccatgagggaacacgttacattaaaagagatgctaggaagattaaagcaagtgaatgaa
gaaagttttcaagtgtgcagtgaacatttggagaaaatccagcaagcaaaccaaatcgga
gaggatggattattatga

DBGET integrated database retrieval system