KEGG   Bacillus megaterium QM B1551: BMQ_1590
Entry
BMQ_1590          CDS       T01208                                 

Gene name
levF
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IIC component
  KO
K11196  fructose PTS system EIIC component
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00051  Fructose and mannose metabolism
bmq02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BMQ_1590 (levF)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BMQ_1590 (levF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmq02000]
    BMQ_1590 (levF)
Transporters [BR:bmq02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BMQ_1590 (levF)
SSDB
Motif
Pfam: EII-Sor
Other DBs
NCBI-ProteinID: ADE68622
UniProt: D5E2J5
LinkDB
Position
1571367..1572173
AA seq 268 aa
MSSIQIILLLVIAAVTGIASVLDEGQSHRPLIACTLVGLVLGDLKTGIILGGTLELMALG
WMNVGLAMAPDTAIASVISTILVITAGQGIGEGIAVAIALAAAGQVLTIFVRTITVFLIH
RADKYAEEGNFKGIEIMHITAMGFQALRVMIPTLIVTLISVSAVQTFLGNIPEVITKGLQ
IGGGIIVVVGYAMVINMMNIPHLKPFFYIGFLLAAFTGFNLVGFGALGLCLALLYQQVMQ
QRNQMQPAGVPAATGSEQVYDDDDDLDA
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtcttccatacaaattattttattattagtcattgcagcggtaactggcatcgcaagc
gtgttggacgaagggcaatcccatcgtcctctcattgcctgcacattagtaggcttggtg
cttggagatttaaaaaccggcattattttaggtggaacactggaattaatggctcttgga
tggatgaatgttggattggcgatggcacctgatacggctattgcttctgttatttcaact
attttagttatcacagctggtcagggtattggtgaaggcattgcggtagccatagcttta
gcagctgcagggcaagtgctcaccatttttgttcgtaccattacagtatttttaattcat
cgagctgataagtatgcggaagaaggaaattttaaaggaattgaaattatgcatattact
gctatgggttttcaagctctccgcgttatgattccaactttaattgttacattaatcagc
gtaagcgccgtgcaaactttcctcggaaatattccggaagttattacaaaaggcctgcaa
attggaggaggaattatcgtggtcgtaggatacgccatggttatcaatatgatgaacatt
cctcatttaaagccctttttctatatcgggttcttattggcggcatttacagggtttaac
ctggtaggatttggagcgctgggtctttgtttagcacttctttatcagcaagtaatgcag
cagcgaaatcaaatgcagccggcaggcgttcccgcagctacagggagcgaacaagtatat
gatgatgacgatgatttagatgcctaa

DBGET integrated database retrieval system