KEGG   Bacillus megaterium QM B1551: BMQ_1591
Entry
BMQ_1591          CDS       T01208                                 

Gene name
levG
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IID component
  KO
K02771  fructose PTS system EIID component
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00051  Fructose and mannose metabolism
bmq02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BMQ_1591 (levG)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BMQ_1591 (levG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmq02000]
    BMQ_1591 (levG)
Transporters [BR:bmq02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BMQ_1591 (levG)
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: ADE68623
UniProt: D5E2J6
LinkDB
Position
1572200..1573027
AA seq 275 aa
MENEKRLTKKDIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKRLYGPGAQRNAALKR
HLEWFNTHPWISAPIFGVTAAMEEEMANKKDFDEKAISGMKIGLMGPLAGVGDPIFWGTL
RPVLAALGASLALGGNIAGPLLFFILINAIRLSTKYYGLKYGYLKGTEILKDLVGNRIQK
LTEGASILGLFVMGALVSKWTTINIPVVVSRIKDDSGKVVVKTVQDVLDSILPGLLPLAL
TLLVAWMLRKGTNPLLIIFGIFLIGIGGYWIGFLG
NT seq 828 nt   +upstreamnt  +downstreamnt
atggaaaatgaaaaaagattaacgaaaaaagatatctttagcatgttcattcgttcgaat
tttttactcggttcatttaactttgagcgtgttcaagcaatgggctactgttatgttatg
attccagcaatcaagcgcttatatggaccaggagctcagcgaaatgcagcattaaaacgt
catttagaatggttcaatacacacccatggatttccgcacctatattcggcgtcacggca
gcaatggaagaagaaatggcaaacaaaaaagattttgatgaaaaagctatcagcggaatg
aaaattggattaatgggcccgcttgctggtgtaggagaccctattttctggggaacgctt
cgaccagttctcgcagccctaggcgcatcgcttgcgttaggagggaatattgccgggcca
ctgctgtttttcatcttaattaatgcaattcgattaagtacaaaatattatggattaaaa
tatggctacttaaaaggaacagaaattttaaaagatttagtaggcaatcgaattcaaaaa
ctgacagaaggtgcatccattttaggactcttcgtaatgggagcgttggtttcgaaatgg
accactattaatataccagtggtcgtttctaggatcaaagatgattctggtaaagttgtg
gtaaaaaccgtgcaagacgtacttgatagtattctaccggggctacttcctttagcgcta
actttattagtagcatggatgcttcgaaaaggtacaaatccgctgcttattattttcggt
attttcttaattggtataggaggttattggataggctttttaggttga

DBGET integrated database retrieval system