KEGG   Bacillus megaterium QM B1551: BMQ_2326Help
Entry
BMQ_2326          CDS       T01208                                 

Gene name
nprM
Definition
(GenBank) Bacillolysin precursor (neutral protease)
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
bmq  Bacillus megaterium QM B1551
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bmq01002]
    BMQ_2326 (nprM)
Enzymes [BR:bmq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     BMQ_2326 (nprM)
Peptidases [BR:bmq01002]
 Metallo Peptidases
  Family M4: thermolysin family
   BMQ_2326 (nprM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY CactinC_cactus
Motif
Other DBs
NCBI-ProteinID: ADE69349
UniProt: D5DRY6
LinkDB All DBs
Position
2327870..2329558
Genome map
AA seq 562 aa AA seqDB search
MKKKKQALKVLLSVGILSSSFAFAHTSSAAPNNVLSTEKYNKEIKSPEFISGKLSGPSSQ
KAQDVVFHYMNKNKDKYKLGNENAQNSFKVTEVVKDPVEQATVVRLQQVYNNIPVWGSTQ
LAHVAKDGTLKVVSGTVAPDLDKKEKLKGQKQVDSKKAIQAAEKDLGFKPTYEKSPSSEL
YVYQNGSDTTYAYVVNLNFLSPEPGNYYYFVDAINGKVLDKYNTIDSVAGPKADVKQAAK
PAAKPVTGTNAIGSGKGVLGDTKSLKTTLSSSTYYLQDNTRGATIYTYDAKNRTSLPGTL
WADTDNTYNATRDAAAVDAHYYAGVTYDYYKNKFNRNSYDNAGAPLKSTVHYSSGYNNAF
WNGSQMVYGDGDGYTFVPLSGGLDVIGHELTHAVTERSSNLIYQYESGALNEAISDIFGT
LVEYYDNRNPDWEIGEDIYTPGTSGDALRSMSNPAKYGDPDHYSKRYTGSSDNGGVHTNS
GIINKAAYLLANGGTHYGVTVTGIGGDKLGKIYYRANTLYFTQSTTFSQARAGLVQAAAD
LYGSGSQEVISVGKSFDAVGVQ
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaaaacaggctttaaaggtattattatcagttggtattctttcttcatca
tttgcttttgcacatacgagcagtgccgcgccaaataatgtactttcaactgaaaagtac
aacaaagaaattaaatctcctgagtttatttctgggaagctctcaggcccatcatcacag
aaagctcaagacgtcgtatttcactatatgaataaaaataaagacaaatataaattagga
aacgaaaatgcccaaaactcgtttaaagtaacagaagtagtgaaagatcccgttgaacaa
gcaaccgttgtacgcttgcagcaggtatacaataatattcctgtatggggatctactcaa
ttagcacacgtagcgaaagatggaaccttaaaagttgtatcaggtacagtagctcctgat
ttagataaaaaggaaaagctaaaaggacagaagcaagttgacagcaaaaaggcgattcaa
gcagctgaaaaagatttaggctttaaaccgacgtatgaaaaatccccttcatctgaactg
tatgtttatcaaaatggttcagacacaacgtatgcttatgtagtaaatttaaatttctta
agccctgaaccaggcaactattattactttgttgatgctattaacggtaaagtgctagat
aagtacaatacgattgattccgtagctggtccaaaagccgacgtgaagcaagcggcaaag
ccggcagcgaaacctgtaacaggcacaaatgctattggctcaggtaaaggagtgcttgga
gatactaaatccttaaagacaacgttatctagttctacttactacttacaagataataca
agaggcgccacaatctatacgtacgatgcaaaaaatcgtacatctcttccgggtactcta
tgggcagataccgataatacgtacaatgcaacccgcgatgcagctgcagtagatgctcac
tattatgcaggtgtgacatatgattattataaaaacaaatttaaccgcaactcctatgac
aatgcaggagctccgctaaaatcgactgttcattatagcagcggctacaataatgcgttt
tggaatggctctcaaatggtatatggagatggagatggatatacttttgttccgttatca
ggaggattagacgttatcggacatgaattgacgcatgcggtcacagaaagaagttctaat
ttaatctatcaatatgaatcaggtgcattaaacgaagcaatttccgatattttcggaaca
ttggtagaatactatgacaaccgcaatccagattgggaaattggagaagatatttatacg
cctggaacaagcggtgatgcccttcgttcaatgagcaacccagcaaaatatggagatccg
gatcattattcaaagcgctatacaggttctagtgacaacggcggagttcatacaaacagc
ggtattatcaacaaagcggcctacttgctagctaacggaggaacgcattacggggttact
gtaacaggcatcggcggcgataagctaggaaaaatttattaccgtgccaatacgctatac
ttcactcagtctacaacgtttagccaagcgcgtgcaggtttagtacaagctgctgctgat
ttatacggttcaggctctcaagaagtaatttcagtaggcaagtcatttgacgcagttggt
gttcaataa

DBGET integrated database retrieval system