KEGG   Bacillus megaterium QM B1551: BMQ_2467Help
Entry
BMQ_2467          CDS       T01208                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00250  Alanine, aspartate and glutamate metabolism
bmq00410  beta-Alanine metabolism
bmq00430  Taurine and hypotaurine metabolism
bmq00650  Butanoate metabolism
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
bmq01120  Microbial metabolism in diverse environments
bmq02024  Quorum sensing
Module
bmq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BMQ_2467
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMQ_2467
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BMQ_2467
   00430 Taurine and hypotaurine metabolism
    BMQ_2467
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BMQ_2467
Enzymes [BR:bmq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BMQ_2467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC dCache_3
Motif
Other DBs
NCBI-ProteinID: ADE69489
UniProt: D5DSQ6
LinkDB All DBs
Position
complement(2461782..2463185)
Genome map
AA seq 467 aa AA seqDB search
MPQWHPHREQKNLPDEFPVNPLFSRQGEVTIPRLRIGDQGMLPETAYQIIHDEIALDGNA
RLNLATFVTTWMEPDAKRLYGESFDKNMIDKDEYPQTAAIEERCVRILADLWNSPNPDTT
MGVSTTGSSEACMLGGLALKRRWQKLRKSKGLSTDRPNIVFSSSVQVVWEKFANYWDVEP
RYVNINPDHPYLDAEGVINAVDENTIGVVPILGVTYTGVYEPIAAIAKALDELQEKTGLD
IPIHVDAASGGFIAPFLQPDLIWDFRLPRVKSINVSGHKYGLVYPGLGWVIWREKEDLPE
DLIFRVSYLGGNMPTFALNFSRPGAQVLLQYYNFLRLGKDGYYAVQKTSQENALFLSKEI
GEMDAFEILADGSDIPVLAWKLKEDYTPNWTLYDLSRQLRTYGWQVPAYPLPADMEEITI
MRIVVRNGFSRDLAHLFMVNFKQAVEFLNSLDRPVLKDTKYDNGFHH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaatggcacccacatcgtgaacaaaaaaatttacctgatgaatttcctgttaat
ccgcttttttctcgacaaggagaagtgacgattccaagactgcgtatcggtgatcaaggt
atgcttccggaaacggcctatcaaatcattcatgacgaaattgctttagacggaaatgcc
cgcttgaatttagctacgtttgttactacgtggatggagcctgatgcaaagcgtttgtac
ggagaatcttttgataaaaatatgatcgataaagatgagtatccgcagacagcggctatt
gaagagagatgtgtacgtattttagcggatttgtggaattcacctaatcctgataccacg
atgggcgtttctactacaggttcatctgaagcatgtatgcttggtggactagcgttaaaa
agacgatggcagaaactgcgtaaaagtaaagggctatcaacggaccgccccaatattgta
tttagttcatcggttcaagtggtatgggagaagttcgcaaactattgggacgtagagcct
cgttatgtgaatattaatccagatcatccttatttagatgcagaaggcgtgattaatgcg
gttgacgaaaatacaattggcgtcgtaccgattctcggagtcacgtatacaggggtttac
gaaccaatagctgctatcgcaaaagcattagatgagttacaggaaaaaacagggttggat
attcctatccatgtagatgctgcttctggaggttttatcgctccatttcttcaaccagac
cttatctgggatttccgcttgccgcgagtaaagtccattaacgtgtcaggacacaagtat
ggtttagtttaccctggcttgggatgggtgatttggagagaaaaagaggacttgcctgaa
gatcttattttccgcgtttcttatttagggggcaacatgccaacttttgcgctcaacttc
tctagaccaggagcacaagtccttttgcagtactacaatttcttgcgtttaggtaaagac
ggctattatgccgtgcaaaaaacctcccaagaaaacgcgctgtttcttagcaaagaaatt
ggagaaatggacgcattcgaaattcttgctgatggttcagatatcccggttcttgcttgg
aaactgaaagaagactatacaccaaactggactctttatgatttgtctagacaactgcgt
acgtacggatggcaagttcctgcttacccactcccagcagacatggaagaaatcacaatc
atgcgcattgttgttagaaatgggttttcaagagaccttgctcatttatttatggttaat
ttcaaacaagccgttgaatttcttaactcgttggatagacctgttcttaaagacacgaaa
tacgacaatggatttcatcattaa

DBGET integrated database retrieval system