KEGG   Bacillus megaterium QM B1551: BMQ_3348Help
Entry
BMQ_3348          CDS       T01208                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier protein] reductase I
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00061  Fatty acid biosynthesis
bmq00780  Biotin metabolism
bmq01100  Metabolic pathways
bmq01130  Biosynthesis of antibiotics
bmq01212  Fatty acid metabolism
Module
bmq_M00083  Fatty acid biosynthesis, elongation
bmq_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BMQ_3348 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BMQ_3348 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BMQ_3348 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bmq01004]
    BMQ_3348 (fabI)
Enzymes [BR:bmq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BMQ_3348 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BMQ_3348 (fabI)
Lipid biosynthesis proteins [BR:bmq01004]
 Fatty acid synthase
  Component type
   BMQ_3348 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ADE70370
UniProt: D5DZG9
LinkDB All DBs
Position
complement(3262396..3263175)
Genome map
AA seq 259 aa AA seqDB search
MEDLLQLKNKNFVIMGVANDRSIAWGVAKALHQVGANLIFTYRKERSLGKLNKLLEKNEI
QATLIAECDVNSDESIEAAFKKIGEEAGTVHGVIHSVAFAHSEDLNGEFINTSRSGYAFA
QDTSAYSFIAVAKAAKPLMTEGGSLVAMSYLGAERAVEGYNVMGVAKAALESSVKYLALD
LGKDNIRVNAISAGPIRTLAAKGISDFNQILHHVEEKAPLKRNVTQAEVGDMTVVLLSHL
SRGVTGEIVHVDAGYNIVG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaagatttattacaattaaagaacaagaactttgttattatgggagttgccaacgac
agaagtattgcttggggtgttgcaaaagcccttcatcaagtaggagcaaacttaattttt
acataccgtaaagaacgttcactaggaaaattgaacaagctgttagaaaaaaatgaaatt
caagcgacattaattgcagaatgtgatgtaaacagcgacgaaagcattgaagcagctttc
aaaaaaatcggagaagaagcaggcacagttcacggagtgattcactctgttgcgtttgct
cactcagaagatttaaacggtgagttcatcaatacatcaagaagcggatatgcatttgct
caagatacaagcgcttattcatttatcgccgtagcgaaagcagcaaaacctcttatgaca
gaaggcggttctcttgtagcgatgagctatcttggtgcagagcgcgcagttgaaggctat
aacgtaatgggcgtagcaaaagcagcgcttgagtcttcagtaaaatacttagcattagac
ttagggaaagacaatatccgcgtaaatgcgatttcagcaggcccaattcgtacacttgca
gcgaaaggcatttctgactttaaccaaattcttcaccatgttgaagaaaaagcacctctt
aagcgtaacgtaacgcaagcagaagttggcgacatgacggttgtattactgagccacctt
tcacgcggcgtaacgggagaaatcgtacacgtggacgctggttacaatattgtaggttaa

DBGET integrated database retrieval system