KEGG   Bacillus megaterium QM B1551: BMQ_4723Help
Entry
BMQ_4723          CDS       T01208                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00020  Citrate cycle (TCA cycle)
bmq00190  Oxidative phosphorylation
bmq00650  Butanoate metabolism
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
bmq01120  Microbial metabolism in diverse environments
bmq01130  Biosynthesis of antibiotics
bmq01200  Carbon metabolism
Module
bmq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMQ_4723 (sdhB)
   00650 Butanoate metabolism
    BMQ_4723 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BMQ_4723 (sdhB)
Enzymes [BR:bmq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BMQ_4723 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BMQ_4723 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_20 Fer4_2 Fer4 Fer4_18 Fer4_13 Fer4_4 Fer4_21 Fer4_3 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ADE71725
UniProt: D5DTP9
LinkDB All DBs
Position
complement(4545337..4546110)
Genome map
AA seq 257 aa AA seqDB search
MSEQQTVQKTVRFIITRQDSAESAPYNQEFEIPYRPNMNVISALMEIRRNPVDASGKEVA
PINWEMNCLEEVCGACSMVINGKPRQSCTALVDKLEQPIRLQPMKTFPVVRDLQVDRSRM
FDSLKKVKAWVPIDGTYDLGPGPRMPEKKRQWAYELSKCMTCGVCLEACPNVNDKSNFIG
PAPLSQVRLFNAHPTGALNKGERLETIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALN
RDTTIQAFRSFFGSDQV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaacaaacagtccaaaagacagtgcgcttcattattacacgtcaagattca
gctgaatctgctccttacaatcaggagtttgaaattccgtatcgtccgaatatgaacgtt
atttcagcactgatggaaatcagacgtaaccctgttgatgcttcaggtaaagaggttgct
ccgataaactgggaaatgaactgtttagaggaagtatgcggagcctgttcaatggtcatc
aacggtaaacctcgtcagtcatgtacggctcttgttgataaactagaacagccaattcgc
ttacagccaatgaaaacatttcctgtggttcgtgacttgcaagtagaccgcagccgtatg
tttgattcactaaaaaaagtaaaagcctgggttccaatcgatggcacatacgatttaggt
ccaggaccgcgtatgcctgaaaagaaacgtcagtgggcgtatgagttatccaagtgtatg
acatgtggcgtttgcttagaagcttgtccaaacgtaaacgacaagtcaaacttcatcggt
ccagcaccgctttctcaagttcgcttgtttaatgcccatccaaccggtgcgttaaataaa
ggagaacgtttagagacgattatgggtgatggaggactagcgaactgcgggaactctcaa
aactgcgttcaatcatgtccaaaaggaattccattgactacttcaatcgcagctttgaac
cgcgatacaacaattcaagcattcagaagtttctttggtagcgatcaagtataa

DBGET integrated database retrieval system