KEGG   Bacillus megaterium QM B1551: BMQ_4724Help
Entry
BMQ_4724          CDS       T01208                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00020  Citrate cycle (TCA cycle)
bmq00190  Oxidative phosphorylation
bmq00650  Butanoate metabolism
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
bmq01120  Microbial metabolism in diverse environments
bmq01130  Biosynthesis of antibiotics
bmq01200  Carbon metabolism
Module
bmq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMQ_4724 (sdhA)
   00650 Butanoate metabolism
    BMQ_4724 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BMQ_4724 (sdhA)
Enzymes [BR:bmq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BMQ_4724 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BMQ_4724 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like GIDA Pyr_redox FAD_oxidored NAD_binding_8 RNase_H_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ADE71726
UniProt: D5DTQ0
LinkDB All DBs
Position
complement(4546114..4547901)
Genome map
AA seq 595 aa AA seqDB search
MSNGKIIVVGGGLAGLMATIKIAESGKQVDLFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWEHFDDTVYGGDFLANQPPVKAMCEAAPGIIHLLDRMGVMFNRTPEGLLDFRRFGGTQ
HHRTAFAGATTGQQLLYALDEQVRRYEVAGLVTKYEGWEFLGAVLDDERSCRGISAQNLK
SMEIKTFPADAVIMATGGPGIVFGKSTNSVINTGSAASIVYQQGAYYSNGEFIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVAQK
LGINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFMGDDPRKVPMKIFPAVHYSMGGLWV
DYDQMTNIPGLFAAGECDYSQHGANRLGANSLLSAIYGGMVAGPKAVEYINGLEKSADAI
SSSVYDRHVKEEEEKWNNIMNLQGTENAYVLHKELGEWMTDNVTVVRYNDKLLKTDEKIQ
ELIERYDRININDTAKWSNQAATFTRQLQNMLQLSRVVTLGAYNRNESRGAHYKPDFPDR
NDEEFLKTTMASFVDKKTAPSFHYEEVDVSLIKPRKRDYTKKKDEKPKKQQEGVR
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacggaaaaatcatcgtagtcggtggcggtttagctggcttgatggcaacaata
aaaattgctgagtctggcaagcaagtagatttattttcactagttccggtaaaaagatct
cactcagtttgcgcgcaaggtggaatcaacggagccgtaaatacgaaaggtgaaggggat
tcaccatgggaacactttgatgacacagtgtacggcggagactttttagccaaccagcca
cctgtaaaagcaatgtgtgaagcagctcctggcattattcacttacttgaccgcatgggt
gttatgtttaaccgtactcctgagggtttgttagacttcagacgatttggcgggacgcag
catcaccgtacggcttttgctggagcaacaacgggtcaacaattattgtacgcattagat
gagcaggttcgtcgctatgaagttgccggacttgtgacaaagtacgaaggatgggaattc
ttaggtgctgttcttgacgatgagcgcagctgtcgcggaatttctgcacagaatttaaaa
tcaatggaaattaaaacgttcccagctgacgcggttattatggctacaggtggacctgga
attgtttttggaaaatcgacgaactcagttattaatacaggttcagcggcatctattgtg
tatcagcaaggtgcatactattcaaacggagagtttattcaaattcatccaactgctatc
ccaggagatgataagcttcgtcttatgagtgaatctgctcgtggagaaggcggacgcgtt
tggacatataaagacggtaaaccttggtatttcttagaggaaaaatatcctgcatacggt
aacttagtacctcgtgatattgcaactcgtgaaatttttgacgtctgcgtagcgcagaag
ttaggaattaacggagagaacatggtttatctggacctttcacataaagatccaaaagag
ctagacattaaacttggaggtatcatcgaaatctatgaaaaattcatgggcgatgatccg
cgcaaggtaccaatgaaaattttcccagccgtacactattcaatgggcggtttatgggtg
gattacgatcaaatgacaaatattcctggcttattcgcagctggtgagtgtgattattca
cagcacggagcgaaccgtttaggagcaaactcattattatcagctatttatggtggtatg
gttgccggtcctaaagcggttgaatacatcaatggtttagaaaagagcgcagatgctatt
tcttcaagcgtatatgatcgtcatgtgaaagaagaagaagagaaatggaacaatatcatg
aatcttcaaggtacagaaaatgcatacgttcttcataaagagctaggggaatggatgact
gacaacgtgacagtcgtacgatacaatgacaaactgttaaaaacagatgaaaagattcaa
gaattaattgaacgctatgatcgtattaacattaatgatacggctaaatggagtaatcaa
gcggcaacatttactcgtcagctgcaaaacatgcttcagctttcacgtgttgtaacgcta
ggagcttacaaccgtaacgaaagtcgcggtgctcattataagccagatttcccagatcgt
aacgatgaagaattcttaaaaacaacaatggcatcttttgtggataagaaaacggctcct
tctttccattatgaagaggtagacgtatcgttaatcaaaccgcgtaagcgcgactacaca
aagaaaaaagatgaaaaaccaaaaaaacaacaagagggggttcgttaa

DBGET integrated database retrieval system