KEGG   Bacillus megaterium QM B1551: BMQ_4769Help
Entry
BMQ_4769          CDS       T01208                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00020  Citrate cycle (TCA cycle)
bmq00480  Glutathione metabolism
bmq01100  Metabolic pathways
bmq01110  Biosynthesis of secondary metabolites
bmq01120  Microbial metabolism in diverse environments
bmq01130  Biosynthesis of antibiotics
bmq01200  Carbon metabolism
bmq01210  2-Oxocarboxylic acid metabolism
bmq01230  Biosynthesis of amino acids
Module
bmq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmq_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMQ_4769 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BMQ_4769 (icd)
Enzymes [BR:bmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BMQ_4769 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADE71771
UniProt: D5DTU5
LinkDB All DBs
Position
complement(4594556..4595842)
Genome map
AA seq 428 aa AA seqDB search
MTKGEQISVANGVLNVPNNPIIPFIEGDGIGPDIWAAASRVLEAAVAKAYNGEKEIVWKE
VLAGEKAFNQTGEWLPEETLDAIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFTCLR
PVRYFDGVPSPIKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVQKLVSFLQTELGVNKIR
FPETSGLGIKPISSEGTERLVRAAINYAIEQGRKSVTLVHKGNIMKYTEGAFKNWGYELA
EKEFGDKVFTWAQYDRIVEKEGAQAANKAQAEAEAAGKIIVKDSIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVLLSGVLMLEHLGWNEAADLIMKSMEKTIASKVVTYDFARLMDGATEVKCSEFADELIS
NLGKQVTV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaggtgaacaaatttctgtagcaaacggcgtattaaacgtaccaaataaccca
atcattccatttatcgaaggtgacggaattggtccggatatctgggcagcagcttctcgc
gtattagaagcagcggttgcaaaagcatacaatggtgaaaaagaaatcgtttggaaagaa
gtattagcaggtgaaaaagcatttaatcaaactggcgaatggttaccggaagaaacgtta
gatgcaattcgcgaatacataattgcaatcaaaggaccattaacaacaccagtaggcggt
ggaattcgttctctaaacgtggcattgcgtcaagaattagacttattcacatgcttacgt
cctgttcgctactttgacggcgtaccttctccaattaagcgccctgaagatacagatatg
gttatcttccgtgaaaatactgaagatatttatgctggtattgaatatgcgaagggttct
gaagaagtacaaaagcttgtttcattcctacaaacggaattaggcgtaaataaaatccgt
ttccctgaaacttctggattaggtattaagcctatttcttctgaaggaacagagcgtctt
gtgcgtgcagcaatcaactatgcaattgaacaaggccgcaagtctgttacgcttgtacac
aaaggtaacattatgaaatatacagaaggcgcatttaaaaattggggctatgagctagct
gaaaaagaattcggcgataaagtatttacttgggctcaatatgaccgcatcgttgaaaaa
gaaggtgcacaggctgcaaacaaagctcaagcagaagcggaagcagcaggaaaaattatt
gtaaaagattcaattgcagatatcttcttacaacaaattttaactcgtccacgtgaattc
gatgtagtagcaacaatgaatttaaatggagattacatttcagatgcattagcagcacaa
gttggtggtatcggaattgctccaggggcaaatatcaactacgaaactggacatgctatc
tttgaagcaactcacggtacagcacctaaatatgctggtttagataaagtaaacccatct
tctgtattattatcaggtgtgttaatgcttgaacaccttggctggaatgaagcagcggat
ttaatcatgaaatcaatggaaaaaacaattgcttcaaaagtagtaacatatgatttcgca
cgtttaatggacggcgcaacagaagtgaagtgttcagagtttgctgatgaattaattagc
aatctaggaaaacaagtaacagtttaa

DBGET integrated database retrieval system