KEGG   Bacillus megaterium QM B1551: BMQ_5116Help
Entry
BMQ_5116          CDS       T01208                                 

Gene name
comFC
Definition
(GenBank) ComFC transformation protein
  KO
K02242  competence protein ComFC
Organism
bmq  Bacillus megaterium QM B1551
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmq02044]
    BMQ_5116 (comFC)
Secretion system [BR:bmq02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   BMQ_5116 (comFC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase PRTase_3 PRTase_2
Motif
Other DBs
NCBI-ProteinID: ADE72094
UniProt: D5DWC9
LinkDB All DBs
Position
complement(4919997..4920494)
Genome map
AA seq 165 aa AA seqDB search
MDCQKWNDASFFNRSLYTYNDFMQSIIERFKFQGDYEIIQAFKEQWYKFYKKECNPKAIL
VPIPLTDERLYERGFNQSLALAELISDNIEMPLVRCSGTKQSKKNRRSRLAERLEFKVVD
SSMVTNQEFLLIDDIYTTGATVRQAANCLQEAGAHSVRSLTLIRA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggactgtcagaaatggaatgatgcttcttttttcaaccgttctctttatacgtacaat
gattttatgcaaagcataatagaacgttttaaatttcaaggagattatgaaattatccaa
gcattcaaggagcagtggtataagttctataaaaaagaatgtaatccaaaagctatacta
gttcctatacctttaacggacgagagattatatgagagagggtttaaccaatctttagcg
ctagctgaactgatcagtgacaacatagaaatgcctcttgttcgctgttcaggaacaaag
caatcaaagaaaaataggcgaagtcggctggcagaaaggctggaatttaaagtagtcgat
tcctcaatggttacgaatcaagaatttctcttgattgatgatatttatacaacaggagca
accgtgcgccaagcggcaaattgtttgcaggaagctggggcacattcagttcgttcgctc
actttaattcgtgcatga

DBGET integrated database retrieval system