KEGG   Bacillus megaterium QM B1551: BMQ_5147Help
Entry
BMQ_5147          CDS       T01208                                 

Gene name
atpC
Definition
(GenBank) ATP synthase F1, epsilon subunit
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00190  Oxidative phosphorylation
bmq01100  Metabolic pathways
Module
bmq_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BMQ_5147 (atpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bmq00194]
    BMQ_5147 (atpC)
Photosynthesis proteins [BR:bmq00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BMQ_5147 (atpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE
Motif
Other DBs
NCBI-ProteinID: ADE72125
UniProt: P12699
LinkDB All DBs
Position
complement(4952980..4953384)
Genome map
AA seq 134 aa AA seqDB search
MKTIHVSVVTPDGPVYESEVEMVSTRAQSGELGILHGHIPMVAPLQIGAVRLKKASSTEL
VAVSGGFLEVRPDKVTILAQAAETAEEIDVARAEEAKKRAEMRLDSKQDDVDVKRAEIAL
KRAVNRLDISQRKF
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaatccatgtcagtgtagtgactcctgatggcccagtttacgaatcagaagtg
gaaatggtaagtacccgagcacagagcggtgagcttggtattttacatggccatattccg
atggttgctcctttacaaattggagccgtccgcttgaagaaagcaagcagtacagaactt
gtggctgttagcggaggatttcttgaagtaagacctgacaaagtaacaattcttgcacag
gctgctgaaacagctgaagagattgacgtagctcgtgcagaagaagcgaaaaagcgcgct
gaaatgcgccttgatagcaaacaagatgacgttgatgttaagcgtgctgaaattgccttg
aaacgggcagtcaatcgtttagatattagtcaacgtaagttctaa

DBGET integrated database retrieval system