KEGG   Bacillus megaterium QM B1551: BMQ_5228Help
Entry
BMQ_5228          CDS       T01208                                 

Gene name
cydC
Definition
(GenBank) ABC transporter, CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BMQ_5228 (cydC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmq02000]
    BMQ_5228 (cydC)
Transporters [BR:bmq02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    BMQ_5228 (cydC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N RsgA_GTPase AAA_29 AAA_21 Zeta_toxin AAA_18 MMR_HSR1 DUF87 AAA_22 AAA_24 AAA_16 Arf AAA_23
Motif
Other DBs
NCBI-ProteinID: ADE72205
UniProt: D5DWP0
LinkDB All DBs
Position
complement(5036331..5038079)
Genome map
AA seq 582 aa AA seqDB search
MMKYKSWIWPYFKTYKYRIFSILLLSMLTIGSACALMFTSGYLISASSLRPETILLVYVP
IVLVRTFGLSRAAFRYAERLVSHDFILRILAKMRTRLYHLIEPLIATSRYQTGDVLGVLA
EDIESLQDLFLRTILPTISAVILYVISIVALGFFSLKFACLIAIYLFLLVVVMPLFSLWH
MKAANQRYKSSKTQLYAKVTDGFLGVADWVLSGQQQSFFHSYNKTENELDGMDRKLKLWT
YYRELFGQLVVAGLIVTMIWFGASLFADKELAGVFIAAFILVVFPLSEALLPVSNAVEKI
PQFEESLNRVQAMEKNWEDVNEKKKHTLSLPYKGSWNSVRLKVEHVSFRYSNEEELVIHD
LSFQVEQGKKIAILGKSGAGKSTLLKLLQGSLVPTEGTVQLNGQSVAEVREDVPKLISVL
NQNPYLFNTSVANNLLLANEEATKEEVIEAMKQVNMHSLVEGLHQGYQTPMLETGQRFSG
GERQRIALARVLLQHTPIVMLDEPTAGLDAITEKRLLSTIFETLQDKTLIWVTHNLVGME
KMDEILFLQDGKIAIRGTHDELLATNSHYQKLYELDHPAKSL
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatataaaagttggatatggccctactttaaaacatataaatatcgtatcttt
tctattttattactaagcatgttaacgattggttctgcttgcgcgttaatgttcacgtca
ggttatttgatttcagcttcttccttacggccagaaacgattttattggtgtatgttcca
attgtacttgtgcgtacatttggtttaagccgagccgctttccgttatgcggagcgtctt
gtcagtcacgattttattcttcgtattttagctaaaatgcgtacacgtctttatcatttg
attgaaccgttaattgctacatctcgctatcaaacaggagatgttttaggagttcttgcg
gaagatattgaaagtttacaagacttgttcttgcgtaccattcttccaacaatttcagct
gttattttatacgttatttcgattgtagctttaggattctttagcctaaagtttgcatgt
ttgattgccatctatttatttttattagtagtagtgatgccgcttttttccctttggcat
atgaaggcagccaatcagcgatataaatcaagcaaaacacagttatatgccaaggtcaca
gacggctttttaggagtggctgattgggtgttaagcggtcagcagcagtcattttttcat
tcgtataacaaaacagaaaatgagttagacggcatggatcgtaagcttaaactatggacg
tattatcgagaattgtttggacaacttgttgtagcaggtttaattgtcacaatgatttgg
tttggggcttctctttttgcagataaagagcttgcaggtgtgtttattgctgcttttatt
ttagtagtatttcctttatctgaagcgctgctgccagtatctaatgcagtagaaaagatt
cctcagtttgaagaatcattaaatagagtacaggcaatggaaaagaactgggaagatgtg
aacgaaaagaaaaaacatactctttctctaccttataaaggttcatggaattcggttaga
ttaaaagttgagcatgtaagctttcgctatagtaatgaggaggagttagtaattcatgat
ctttcatttcaagtcgagcaagggaaaaaaattgcgattcttggcaagagtggagctgga
aaatcgactctattaaagttgctgcaaggctccttagtacctacagaaggtacagttcag
ctaaacggtcagtctgttgctgaagttcgtgaagatgtaccaaaactcatctctgtatta
aatcaaaatccttatttatttaatacaagcgtagccaacaatttattactagctaatgaa
gaggccacaaaagaagaagtaattgaggccatgaagcaagtgaatatgcactcccttgtg
gaaggtttgcaccaaggatatcaaacgccgatgctcgaaacaggtcagcgcttctcggga
ggagaacgtcagcggattgcgctagcacgtgttctgcttcagcatacgccaattgttatg
ctagatgagccaactgcagggttggatgctatcactgaaaagcgtctgttatccactatc
tttgaaactcttcaagacaaaaccctaatttgggttacgcataatttagttgggatggaa
aaaatggatgaaatcttatttttgcaagatggtaagatagccattcgaggaacgcatgac
gaattacttgcgacgaacagtcactatcaaaagctatatgaattggatcatccggcaaaa
agcctttag

DBGET integrated database retrieval system