KEGG   Bacillus megaterium QM B1551: BMQ_5241Help
Entry
BMQ_5241          CDS       T01208                                 

Gene name
amyL
Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00500  Starch and sucrose metabolism
bmq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BMQ_5241 (amyL)
Enzymes [BR:bmq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BMQ_5241 (amyL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: ADE72218
UniProt: D5DXF6
LinkDB All DBs
Position
5053994..5055445
Genome map
AA seq 483 aa AA seqDB search
MERNHTIMQFFEWHVPADGEHWQRLKELAPQLKEQGIDSVWIPPVTKGVSSEDNGYGVYD
LYDLGEFDQKGTVRTKYGTKQELHDAIDACHNHGINVYVDIVMNHKAAADEKETFHVIEV
DPMNRTEEISEPFEIEGWTKFTFEGRGDQYSSFKWNFNHFNGTDYDDKNGKEGVFRIAGE
NKSWNENVDQEFGNYDYLMFANIDYDHPEVREEMIKWGKWLADTLQCDGYRLDAIKHINH
DFIKEFAHELSSSQEKPFYFVGEFWNPELTACQEFLDVIDYQIDLFDVSLHYKLHEASQQ
GRDFDLTTIFDDTLVKTHPLNVVTFVDNHDSQPNESLESWVEDWFKQSAYALILLREDGY
PCVFYGDYFGIGGEHPIEGKEKDISALLHVRYDKAYGQQDDYFDHPNTIGWVRHGVEEFE
KSGCAVVMSNGEDGEKRMFVGEHRSGQTWIDFTNNREDQVVIEEDGYGQFPVNGGSVSVW
AEA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
ttggaacggaatcatacaattatgcaatttttcgaatggcatgtgccagctgatggcgag
cattggcaacgcctcaaagagctcgctcctcaactaaaagaacaaggaattgattccgtg
tggattccccctgttacaaaaggtgtttcatcagaggataatggctacggcgtttacgac
ttatacgatcttggagaatttgatcaaaaaggaaccgttcgtacaaagtatggaaccaag
caagagctgcatgatgcgattgatgcctgtcataatcacggaattaatgtctatgtggat
attgtgatgaatcataaagctgcagcagatgaaaaagaaacgttccacgtcattgaagta
gatcccatgaaccgaacagaagaaatttctgaaccttttgaaattgaagggtggacaaag
tttacatttgaagggcgcggcgatcaatattcttctttcaaatggaactttaatcatttt
aacggcactgattacgatgataaaaatggaaaagaaggcgtttttcgtattgccggggaa
aacaaaagctggaacgaaaatgtcgatcaagagtttggcaactacgattatttaatgttt
gcgaatattgattacgatcaccctgaagttcgagaagaaatgatcaaatggggaaaatgg
ttagcagacaccctgcagtgcgacggttatcgattagacgccattaaacatattaaccac
gattttattaaagagtttgcccacgaattgtcctcttctcaagaaaagccattttatttt
gtgggagagttttggaatccagagttaacagcctgtcaggaattcctagacgtgattgat
tatcaaattgatttgtttgacgtatcgctgcactataaactgcatgaagcctctcagcaa
ggaagagattttgatttaaccacgatttttgatgatacattagtcaagactcaccctttg
aatgttgtcacatttgtagataaccatgactctcagccaaatgaatctttagaatcttgg
gtagaagattggttcaaacaaagtgcttacgctctaattttacttcgtgaagacggctat
ccttgtgtgttttacggagactattttgggataggcggagagcaccctattgagggaaaa
gaaaaagatatttccgctctcttgcatgtacgctatgacaaagcatacggtcagcaagac
gattattttgatcacccgaataccattggatgggtaaggcatggtgtagaggaatttgag
aagtctggatgcgctgtggtgatgtcaaacggcgaagatggcgaaaagagaatgttcgtc
ggcgaacaccgaagtggacaaacgtggatcgacttcacaaacaaccgagaagatcaagtt
gtgattgaagaagatggctacggacagtttcctgtaaatggcggctctgtatccgtttgg
gctgaagcataa

DBGET integrated database retrieval system