KEGG   Brucella microti: BMI_I1146Help
Entry
BMI_I1146         CDS       T00955                                 

Gene name
pyrG
Definition
(GenBank) CTP synthetase
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
bmr  Brucella microti
Pathway
bmr00240  Pyrimidine metabolism
bmr01100  Metabolic pathways
Module
bmr_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:bmr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BMI_I1146 (pyrG)
Enzymes [BR:bmr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     BMI_I1146 (pyrG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_synth_N GATase Peptidase_C26 CbiA
Motif
Other DBs
NCBI-ProteinID: ACU48121
UniProt: C7LC86
LinkDB All DBs
Position
1:complement(1117640..1119268)
Genome map
AA seq 542 aa AA seqDB search
MARYVFITGGVVSSLGKGIAAAALAALLQARGYRVRIRKLDPYLNVDPGTMSPYQHGEVF
VTDDGAETDLDLGHYERFTGRPANQQDNITTGRIYRNIIEKERRGDYLGATVQVIPHVTD
EIKNFVLEGNEDYDFVLCEIGGTVGDIEAMPFLEAIRQLGNELPRGTAVYIHLTLMPYIP
AAGELKTKPTQHSVKELRSIGIAPDILLVRADREIPESERRKLSLFCNVRESAVIQALDV
ATIYDVPIAYHKEGLDSEVLSAFGIDPAPKPRMDRWEEVSHRLHNPEGEVTIAVVGKYTG
LKDAYKSLIEALHHGGLANKVKVNLDWIEAEVFESEDPAPYLEKVHGILVPGGFGERGAE
GKILAAKFARERKVPYFGICFGMQMACIEAARNLVGIEDASSSEFGPTREPVVGLMTEWL
KGNMLEKRAAAGDLGGTMRLGAYEAVLKPDSKIAQIYGSTDIHERHRHRYEVNIDYKDRL
EAAGLNFAGMSPDGVLPETVEYADHPWFIGVQYHPELKSRPFEPHPLFASFIEAAIEQSR
LV
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgatatgtattcatcactggcggcgtggtttcttccctcggaaaaggcatagct
gccgcagcattggctgcactccttcaggcacgcggttatcgtgtgcgtatccgtaaactt
gacccctatctgaatgtcgatccaggcacaatgtcgccttaccagcatggtgaggtgttc
gtcactgacgacggagccgagacagacctcgatctgggccattacgagcggtttaccggt
cgtcccgccaaccagcaggataatatcacgaccggtcgtatctaccgcaatatcatcgaa
aaggaacgccgcggcgattatctcggtgcgacggttcaggtcattcctcatgtgaccgac
gagatcaagaatttcgttcttgagggcaatgaggattatgatttcgtgctgtgcgaaatc
ggcggcacggttggcgatatcgaagccatgccgtttctggaagccattcgccagcttggc
aacgagttgccgcgcggcacggcggtttatatccacctgaccctgatgccctatattccg
gctgcgggcgaattgaagaccaagccgacccagcattcggtcaaggaactgcgttccatc
ggcattgcaccggatattcttctggtgcgtgccgaccgcgaaatcccggaatcggagcgg
cgcaagctgtcgctgttctgcaatgtccgtgaaagcgcggtcattcaggcgcttgatgtt
gcgacaatctacgatgttccgatcgcctatcacaaagaagggctggattcggaagtcctg
tccgcattcggcatcgatccggcgccaaagccgcgcatggatcgctgggaagaggtttcc
catcggctccacaacccggaaggcgaagtgacgattgccgttgtcggtaaatataccggc
ctcaaggatgcctataaatctctcatcgaggcgctgcatcatggcggtctggccaataag
gtgaaggtcaatctcgactggatcgaggcggaagtttttgaaagcgaagacccggctcca
tatctggaaaaggtgcatggcattctggtgccgggcggctttggtgagcgtggtgctgaa
ggcaagattctcgcggcgaaattcgcacgcgagcgcaaggtgccttatttcggtatctgc
tttggtatgcagatggcctgcattgaagcagcgcgcaatctggtcggtatcgaagatgct
tcctcaagcgagtttggcccaaccagggagccggtcgtgggtctcatgaccgaatggctg
aagggcaatatgcttgaaaagcgtgcggcggcgggcgatcttggcggtacgatgcgcctt
ggcgcttatgaagcggtgctgaagcccgactcgaagattgcgcaaatctacggctcgacc
gatatccacgagcgtcaccgccatcgttatgaagtcaatatcgactataaggaccgtctc
gaagcagccggcctgaatttcgctggcatgtcgccggacggcgttttgccggaaacggtc
gaatatgcggatcatccttggtttatcggcgtgcagtaccatccggaactgaaatcccgt
ccgtttgagccgcatccgctttttgcatcctttatcgaagcggccatcgaacagagccgt
ctggtctga

DBGET integrated database retrieval system