KEGG   Brucella microti: BMI_I1413Help
Entry
BMI_I1413         CDS       T00955                                 

Gene name
tcaB
Definition
(GenBank) drug resistance transporter, Bcr/CflA family
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
bmr  Brucella microti
Brite
KEGG Orthology (KO) [BR:bmr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmr02000]
    BMI_I1413 (tcaB)
Transporters [BR:bmr02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    BMI_I1413 (tcaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr Sugarporin_N
Motif
Other DBs
NCBI-ProteinID: ACU48379
UniProt: C7LCZ4
LinkDB All DBs
Position
1:complement(1362149..1363360)
Genome map
AA seq 403 aa AA seqDB search
MASSLVRNAIVLGLLSAIGPFAIDMYLPALPTIATDLRAETGAVQMSLLAFFLALALAQL
FCGPLSDMVGRKLPLYGGLVLFAIGSIGSALAANIDVLVLFRFVQGLGAAAGMVISRAIV
RDLHTGVEAARLMSLLMLVFSISPILAPLTGSIIISFFGWRGVFWAVLLAAGIGIILVAT
AQKETRSVEARLESNISSALRGYGRLLKDRHFLGLVFVGGFGLASLFVYLANSAFVLIDH
YGLTPIQYAVAFSANAVSFFGVSQLNGWLGARFGLGRVMRFAACGFAAAMLAMFAAALMG
HQSLWLVASFLFVGYSFLGLVIPATAVLALEEHGEIAGTASALMGTLHFVIGGVAIGIVG
AYSDGTALPMIGGITGCALAAFVLAQIVLARKSRKRGRATAAA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggcttccagtcttgtgcgcaatgccattgttcttggccttctttcggccatcggtcct
tttgcgattgatatgtatctaccggccctgccgaccattgccaccgatctgcgggcggaa
accggcgcggtgcagatgagcctgctcgccttctttctggcactggcgctggcgcagctt
ttctgcgggcccctgtccgatatggtcgggcgtaaactgccgctttatggcgggctggtg
ctcttcgccataggcagcatcggttcggcgcttgcggccaatatcgacgtgctggtgctg
ttccgtttcgtccagggattgggggctgcggcaggcatggtgatatcgcgcgccatcgtg
cgcgatcttcatacgggtgtcgaggccgcgcgccttatgtcgcttttgatgctggtcttt
tcgatttcgccgattctggccccgctgactggctccatcatcataagctttttcggctgg
cgcggggttttctgggccgtgttgcttgccgccggcatcggcatcatactggttgcgacc
gcgcagaaggaaacgcgcagcgtcgaggcgcggcttgagagcaatatcagcagcgcattg
cgcggttacgggcggctgttgaaggaccgtcatttcctcggcctcgtcttcgtgggcggt
ttcggtcttgcgtccttgttcgtttatctggcgaattccgccttcgtgctgatcgaccat
tatggcctgacaccgatacaatatgccgtggcattttccgccaatgccgtgtcgttcttc
ggcgtttcgcagctcaacggctggcttggcgcgcgtttcggccttggccgggtgatgcgc
tttgctgcttgcggctttgccgcagcaatgcttgccatgttcgcggcggcgctgatgggg
catcaatcactctggctggtcgcaagcttcctctttgtcggttacagcttccttgggctg
gttattccagctacggcggtgctggcgctcgaagaacacggcgagattgccggaacggca
tctgcattgatgggcacgcttcacttcgtcattggtggcgtggcgattggtattgtcgga
gcctattccgatggcacggcgctgccgatgattggcggcatcaccggctgtgcgctggcg
gcgttcgtgctggcgcagatcgtccttgcccgcaagtcgagaaagcgcggcagagcaacg
gcggcagcctga

DBGET integrated database retrieval system