KEGG   Brucella microti: BMI_II917Help
Entry
BMI_II917         CDS       T00955                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bmr  Brucella microti
Pathway
bmr00473  D-Alanine metabolism
bmr01100  Metabolic pathways
bmr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BMI_II917 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BMI_II917 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmr01011]
    BMI_II917 (alr)
Enzymes [BR:bmr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BMI_II917 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bmr01011]
 Precursor biosynthesis
  Racemase
   BMI_II917 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACU50031
UniProt: C7LJ43
LinkDB All DBs
Position
2:909525..910715
Genome map
AA seq 396 aa AA seqDB search
MSLPFSQDERDLAAGGILTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPA
FYEAGCRDFFVAHLGEAVALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVE
NWAALATRLGKKLPALLQFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDE
PGNAANARQLAKMTALLARLPKLPAALANSGGTFLGKTYYFDLARPGIALCGIDPERQHD
FSDKVAHENKKPKHSILPVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYA
DGLFRSLSNKGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLED
VARDCDTIPYEILTALGNRYARVYVYVNGGGTSTTA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtctttacctttttctcaggatgagcgcgatctcgcggctggcggcatattgaccatt
gatctcgcagccctgcgccacaattattcagccatcgcaacccgcattgccccaacccgt
acggccgctgtggtaaaggcagacgcctatggcctgggcgcaagccgggtcgcaccggct
ttctacgaggccggttgccgcgatttcttcgttgcacatcttggcgaagcagtggcgctg
aagccctttttgaaacccgacgcaacactttatgtcctgaacggccttcagcccggaacg
gaagcagcctgtgcccgcgaaggcatcctgcctgttctcaattcgctggaacaggttgaa
aactgggcagcactcgccacccggctgggcaaaaaactgcccgccctgctccagttcgat
accggcatgtctcgtcttggcctgtcagccaaggaatttgaccgccttcttgagaacgtc
acgctcctgagcaggatcgacatcaaattcgccatcagccatctggcaaacggcgacgag
ccgggaaatgcggcaaatgcccgtcagcttgccaagatgacggccttgctcgctcgcctg
ccgaaactgccggctgccttggccaattccggcggcaccttcctcggcaagacctattat
ttcgatctcgcccgccccggcatcgcgctatgtggcatcgatccggagaggcagcatgac
ttttcggataaggtggcgcacgagaataagaaacccaagcattcgatccttcccgtcctc
accctttcggcgcgtgtcattcaggtgcgcgacgtcgacaagggagcgacagttggctat
ggcggcacctatgtcgccaacggcccgatgcggattgcgacgattgcggtcggctatgct
gacggcttgttccgttccttgagtaacaagggcgcagcctttttcggcgatacgcgcctg
cccatcatcgggcgcgtatcgatggattcgatcacgctcgacgtcacctcattgccggag
ggaacgctgaaactcggcagccttgtggaattgatcggcccgcatcagcgcctcgaagac
gtggcgcgggactgcgacactatcccctatgaaattctgactgcgcttggcaaccgttat
gcgcgcgtttacgtttacgtgaatggcggtggcaccagcacaacagcataa

DBGET integrated database retrieval system